Identifiers and Description

Gene Model Identifier

TTHERM_00085600

Standard Name

LIA4 (Localize In macronuclear Anlagen)

Aliases

PreTt16408 | 6.m00482 | 3836.m02076

Description

Localize In macronuclear Anlagen 4 protein - involved in macronuclear differentiation.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF03869 ) Arc-like DNA binding domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00085600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02454.13.00125275364795e-159hypothetical protein (994 aa)

General Information

Paragraph NoGene NameParagraph Text
22LIA4LIA4 is expressed exclusively during conjugation and Lia4p localizes to developing macronuclei. It is required for completion of conjugation, DNA rearrangement, chromosome breakage, and Pdd1 foci (dumposome) formation (Horrell SA and Chalker DL, unpublished data).

Associated Literature

  1. Ref:25084866: Horrell SA, Chalker DL (2014) LIA4 encodes a chromoshadow domain protein required for genomewide DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 13(10):1300-11
  2. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00085600(coding)
ATGGTTGATATTGTTGATGATAGTATGCATAATATGCCTAATATTGATATAAAAGAAGAA
GAGGAAGTTGATTTTAATTTAAATGAAGCTGGAAATAAGAAAAAGCTTTACAGCTCTGAT
GATTCAAAAGATTAAAATGATAATTAAAATAATGTTCTTGAGCCTTCTGTTTTGAATGTA
GAAGCTACAAACGGTAATATACCAGAAAGTGATATTCTATAATAAGTAAACGAAACTATG
GACATCGAATAAAAAGAAAAAGCAAGTGAAAGCAAACAAAAAAAATAATAAAAAGACAAC
AACAAAGATATGTCAGAAGGTAGCTAATTAGAAAATGAAGATTATAAAGATGCTGAGTCA
AGCTAAAGCAAAACAACTTCAGATGAAGATTACTAAAATCCCTTAGAAAAGGGAATGGTA
ATGGAAGAATATGAAGATGATGATGAGTTTATTGGTGTAGAAGAAGAGATTCCTTCCACT
CAATTAGAGCAAAGGAAGAATTCTAGGAAATCAAATGAGAAAAGAGGGCAGAGAAAGAAA
AAAATGATTGAATCTGAAGAAGGAGATGAGGAAGATTCTTCTAATTCAAGTTCTGGTTTT
TCATAAAGAAAAAACTAACTTAATTAAAAGAGAAATACTTCTACAAGAACTAGGAGAAGA
AGAAGATAAAACAGTTAAATTAATGATTCTACTTTTAGTGAAATAAAACCATAGAAAAGA
ACTCGTAGAAAAAAAACAAATGTAGATGAATCAGGATTAAGTTTCAATAATAAAGAAGAT
AATCAACTCATACAAGATGCAATAGATTTTATTAAAAGTAAACCGAGAAGAAGAAGGACA
AGCAAAAAAGAAAATGTAAAATTGGATTCTGAATTTTTAGAAAAAATACAAAAAAAAGCA
AAATCAAATGAAAAAGAAGTTCCTAATAATTTATAGCAAATTAATTTAAATTAAAATGGC
TAAGGACAACAAAATGGGAATATACCATAATAATTCATTGATCTAAATAAGACAATCTCA
AATGAAATTTAATTTTAACAAATAAATCCTTAATTGATACAGTAATAGTTATAATTTTAA
AACTTAGCCTAGCTCTAGTTATAAGCAATGCAGCAATTACCATTTATATTATAGAAATAA
CAGCAATAATAATAATAATAGTAGTAATAGTAGAATTAACAATAAAATGGCTAATTACAA
GCAGCTTTAGCTAATCCACTTTTACTTTAGAATTACTAAAATTAATTTCTTTTGTAAGCT
TAAAGAAACGCTGAAATGCTCATGAATGTTAAAAAGGAGGATCTTTCAAATTAACCACTA
CTAAATCTAGGTTTGCAGTAACAAAATTTAGAGGATAATAAAAATTTACCAAAGTAAACA
ACTCAACTTGTACAATAGAATTCTAACAGCAACCAAACAAACGGAAGACATAGAACTGGA
AGGAGAGGAAGAGGTAGTGTTTAATCTAACTAAACTAGTGGGAAAAATTCTAAAGTAGAT
GAAAGTTTTACTGTAGATGATTTAGGAAGAAGAAAGAAGTATAATACGAGAAGGAAGATT
CAAAAATAGAACTATGCTGAAAGTCCTTTGAATGAAGATAGAGATAAGGAGGAGAATAAA
ACCTCTGAATAAAAAGAGAAATCTGGAAATAAAGATTAAAGAAGTTTAGAAGAAGTTGGT
AATGCTGCAATAGATGAGTCAAATATAGAGTTAATTGAGAAAATTCAAAAGAAAGCTGAA
GAAAAAAAATTAGGAAAGGAAATTGAATAATAGTTAAAAGATTTGTTGAGCAAAATAGAA
AATGAAAAGTAAAATTAAATTCTTAGTCAGATAGTGAATAAATACAACTTAAACACTGAA
AAAATAAAAGAATCATAACCTCCAAAGTAAAACAGTAAAACTAAAGAAGATGTAAAGAAA
AAAGGAACTACAAAAGAAATAATATTGAATCCTCATTAAACTCTTACATAATAACTTGAA
GTTATTGATAATATATCTGTTGATAGTGCAAACGGTGTTAACATTAATTACAGAGAGTCA
GGTTCGTCAGATGAAAATCTGAATCAAATTAAAAATGTTGTAGATCTTGATAAAGAAAAA
GAGCTGAAAAAACCAAAATAGTTATAAACATCATACAAGTTGTTGAATTATGATAAGTTA
GAATAAAAAGGTAATATTTGTTCAAAAGGAAGACAAGATGACAAAAAGACTGCTTAGCCT
GCGAATAATCTAGATTAAGCATCTTAAAATGAAGAAAGTGATGAAGAAGATGATTATATT
AGAGATGAAGTAATTCCAATTACAGGTCATTTTAAATATAAAGATAAAGCTGCTGGAGTC
CTTTCATCAAAAATATTAAATAAAAATATATATCTTGAAATATAATGGGAAAAAAGAAAA
AATGGTGTGACACCAACTCCTACCATCATTAATACTCATGAAGTAAAAGCATATGACACT
GATTTCTTAATAGATTTTTATGAATCTAAAATATTAAAAACAAATGAATCAAAAGCCTAA
AGACTACCTAATCAATAAGTTAGTGGTTCTAAGAATTCACATATTGAGTAACTCAGATAA
GATGTTCATAAAAACTAAATGCAAGTATCTTTACAGCAAAAAGATAAATATTATAAATTA
GTAGAACCCAAAGAAAACTAAGCACTCTCTTTACTTGATAGCCAGACAAATTAATCTAAA
AATACAGAAAATAAAACTGTGAGTAACAATTAAGGTAACACCAGCAACGTTCTAAACCAA
AACAAAAAGTAAATCGACCTTGATTAGTAAAGTGATAACGAAAGCGGTGATGAGGAAATT
ACCCAAAAAGATAAAAATAAAATCTATTAAATAGATACACCATCTAGTAAATCAAGTGAA
GAATTTTGCATTGATCCTTACAGAAAATTCATAGAGGATGAAGGTCTTCTCCCAGAATAA
TTACAATAAGAATTAAAAGAAAAACTCGTTTTTTGA


>TTHERM_00085600(protein)
MVDIVDDSMHNMPNIDIKEEEEVDFNLNEAGNKKKLYSSDDSKDQNDNQNNVLEPSVLNV
EATNGNIPESDILQQVNETMDIEQKEKASESKQKKQQKDNNKDMSEGSQLENEDYKDAES
SQSKTTSDEDYQNPLEKGMVMEEYEDDDEFIGVEEEIPSTQLEQRKNSRKSNEKRGQRKK
KMIESEEGDEEDSSNSSSGFSQRKNQLNQKRNTSTRTRRRRRQNSQINDSTFSEIKPQKR
TRRKKTNVDESGLSFNNKEDNQLIQDAIDFIKSKPRRRRTSKKENVKLDSEFLEKIQKKA
KSNEKEVPNNLQQINLNQNGQGQQNGNIPQQFIDLNKTISNEIQFQQINPQLIQQQLQFQ
NLAQLQLQAMQQLPFILQKQQQQQQQQQQQQNQQQNGQLQAALANPLLLQNYQNQFLLQA
QRNAEMLMNVKKEDLSNQPLLNLGLQQQNLEDNKNLPKQTTQLVQQNSNSNQTNGRHRTG
RRGRGSVQSNQTSGKNSKVDESFTVDDLGRRKKYNTRRKIQKQNYAESPLNEDRDKEENK
TSEQKEKSGNKDQRSLEEVGNAAIDESNIELIEKIQKKAEEKKLGKEIEQQLKDLLSKIE
NEKQNQILSQIVNKYNLNTEKIKESQPPKQNSKTKEDVKKKGTTKEIILNPHQTLTQQLE
VIDNISVDSANGVNINYRESGSSDENLNQIKNVVDLDKEKELKKPKQLQTSYKLLNYDKL
EQKGNICSKGRQDDKKTAQPANNLDQASQNEESDEEDDYIRDEVIPITGHFKYKDKAAGV
LSSKILNKNIYLEIQWEKRKNGVTPTPTIINTHEVKAYDTDFLIDFYESKILKTNESKAQ
RLPNQQVSGSKNSHIEQLRQDVHKNQMQVSLQQKDKYYKLVEPKENQALSLLDSQTNQSK
NTENKTVSNNQGNTSNVLNQNKKQIDLDQQSDNESGDEEITQKDKNKIYQIDTPSSKSSE
EFCIDPYRKFIEDEGLLPEQLQQELKEKLVF


>TTHERM_00085600(gene)
ATGGTTGATATTGTTGATGATAGTATGCATAATATGCCTAATATTGATATAAAAGAAGAA
GAGGAAGTTGATTTTAATTTAAATGAAGCTGGAAATAAGAAAAAGCTTTACAGCTCTGAT
GATTCAAAAGATTAAAATGATAATTAAAATAATGTTCTTGAGCCTTCTGTTTTGAATGTA
GAAGCTACAAACGGTAATATACCAGAAAGTGATATTCTATAATAAGTAAACGAAACTATG
GACATCGAATAAAAAGAAAAAGCAAGTGAAAGCAAACAAAAAAAATAATAAAAAGACAAC
AACAAAGATATGTCAGAAGGTAGCTAATTAGAAAATGAAGATTATAAAGATGCTGAGTCA
AGCTAAAGCAAAACAACTTCAGATGAAGATTACTAAAATCCCTTAGAAAAGGGAATGGTA
ATGGAAGAATATGAAGATGATGATGAGTTTATTGGTGTAGAAGAAGAGATTCCTTCCACT
CAATTAGAGCAAAGGAAGAATTCTAGGAAATCAAATGAGAAAAGAGGGCAGAGAAAGAAA
AAAATGATTGAATCTGAAGAAGGAGATGAGGAAGATTCTTCTAATTCAAGTTCTGGTTTT
TCATAAAGAAAAAACTAACTTAATTAAAAGAGAAATACTTCTACAAGAACTAGGAGAAGA
AGAAGATAAAACAGTTAAATTAATGATTCTACTTTTAGTGAAATAAAACCATAGAAAAGA
ACTCGTAGAAAAAAAACAAATGTAGATGAATCAGGATTAAGTTTCAATAATAAAGAAGAT
AATCAACTCATACAAGATGCAATAGATTTTATTAAAAGTAAACCGAGAAGAAGAAGGACA
AGCAAAAAAGAAAATGTAAAATTGGATTCTGAATTTTTAGAAAAAATACAAAAAAAAGCA
AAATCAAATGAAAAAGAAGTTCCTAATAATTTATAGCAAATTAATTTAAATTAAAATGGC
TAAGGACAACAAAATGGGAATATACCATAATAATTCATTGATCTAAATAAGACAATCTCA
AATGAAATTTAATTTTAACAAATAAATCCTTAATTGATACAGTAATAGTTATAATTTTAA
AACTTAGCCTAGCTCTAGTTATAAGCAATGCAGCAATTACCATTTATATTATAGAAATAA
CAGCAATAATAATAATAATAGTAGTAATAGTAGAATTAACAATAAAATGGCTAATTACAA
GCAGCTTTAGCTAATCCACTTTTACTTTAGAATTACTAAAATTAATTTCTTTTGTAAGCT
TAAAGAAACGCTGAAATGCTCATGAATGTTAAAAAGGAGGATCTTTCAAATTAACCACTA
CTAAATCTAGGTTTGCAGTAACAAAATTTAGAGGATAATAAAAATTTACCAAAGTAAACA
ACTCAACTTGTACAATAGAATTCTAACAGCAACCAAACAAACGGAAGACATAGAACTGGA
AGGAGAGGAAGAGGTAGTGTTTAATCTAACTAAACTAGTGGGAAAAATTCTAAAGTAGAT
GAAAGTTTTACTGTAGATGATTTAGGAAGAAGAAAGAAGTATAATACGAGAAGGAAGATT
CAAAAATAGAACTATGCTGAAAGTCCTTTGAATGAAGATAGAGATAAGGAGGAGAATAAA
ACCTCTGAATAAAAAGAGAAATCTGGAAATAAAGATTAAAGAAGTTTAGAAGAAGTTGGT
AATGCTGCAATAGATGAGTCAAATATAGAGTTAATTGAGAAAATTCAAAAGAAAGCTGAA
GAAAAAAAATTAGGAAAGGAAATTGAATAATAGTTAAAAGATTTGTTGAGCAAAATAGAA
AATGAAAAGTAAAATTAAATTCTTAGTCAGATAGTGAATAAATACAACTTAAACACTGAA
AAAATAAAAGAATCATAACCTCCAAAGTAAAACAGTAAAACTAAAGAAGATGTAAAGAAA
AAAGGAACTACAAAAGAAATAATATTGAATCCTCATTAAACTCTTACATAATAACTTGAA
GTTATTGATAATATATCTGTTGATAGTGCAAACGGTGTTAACATTAATTACAGAGAGTCA
GGTTCGTCAGATGAAAATCTGAATCAAATTAAAAATGTTGTAGATCTTGATAAAGAAAAA
GAGCTGAAAAAACCAAAATAGTTATAAACATCATACAAGTTGTTGAATTATGATAAGTTA
GAATAAAAAGGTAATATTTGTTCAAAAGGAAGACAAGATGACAAAAAGACTGCTTAGCCT
GCGAATAATCTAGATTAAGCATCTTAAAATGAAGAAAGTGATGAAGAAGATGATTATATT
AGAGATGAAGTAATTCCAATTACAGGTCATTTTAAATATAAAGATAAAGCTGCTGGAGTC
CTTTCATCAAAAATATTAAATAAAAATATATATCTTGAAATATAATGGGAAAAAAGAAAA
AATGGTGTGACACCAACTCCTACCATCATTAATACTCATGAAGTAAAAGCATATGACACT
GATTTCTTAATAGATTTTTATGAATCTAAAATATTAAAAACAAATGAATCAAAAGCCTAA
AGACTACCTAATCAATAAGTTAGTGGTTCTAAGAATTCACATATTGAGTAACTCAGATAA
GATGTTCATAAAAACTAAATGCAAGTATCTTTACAGCAAAAAGATAAATATTATAAATTA
GTAGAACCCAAAGAAAACTAAGCACTCTCTTTACTTGATAGCCAGACAAATTAATCTAAA
AATACAGAAAATAAAACTGTGAGTAACAATTAAGGTAACACCAGCAACGTTCTAAACCAA
AACAAAAAGTAAATCGACCTTGATTAGTAAAGTGATAACGAAAGCGGTGATGAGGAAATT
ACCCAAAAAGATAAAAATAAAATCTATTAAATAGATACACCATCTAGTAAATCAAGTGAA
GAATTTTGCATTGATCCTTACAGAAAATTCATAGAGGATGAAGGTCTTCTCCCAGAATAA
TTACAATAAGAATTAAAAGAAAAACTCGTTTTTTGA