Identifiers and Description

Gene Model Identifier

TTHERM_00675850

Standard Name

LIA3 (localized in macronuclear anlagen 3)

Aliases

PreTt11026 | 101.m00181

Description

a parallel G quadruplex-binding protein that regulates DNA elimination boundaries

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01784 ) conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00675850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_207380
Tetrahymena borealisEI9_14253.19.997093137033517e-262hypothetical protein (405 aa)

General Information

Paragraph NoGene NameParagraph Text
112LIA3In cells lacking LIA3 (ΔLIA3), the excision of IESs bounded by specific G-rich polypurine tracts was impaired and imprecise, whereas the removal of IESs without such controlling sequences was unaffected. Lia3p binds to oligonucleotides containing these polypurine tracts, which form parallel G-quadruplex structures in vitro.

Associated Literature

  1. Ref:26950070: Carle CM, Zaher HS, Chalker DL (2016) A Parallel G Quadruplex-Binding Protein Regulates the Boundaries of DNA Elimination Events of Tetrahymena thermophila. PLoS genetics 12(3):e1005842
  2. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00675850(coding)
ATGAAATCTCATTCAAAGAAATACCAAGTAACAAATAATTTAGATGCTGACAATGAATTA
TATCCTCAATCACAAATTTAGAGTTCCAATAATGATTAGTAAACTCAACTGAACAGTCAA
GAAGAAAATAACCCTGATATGATTGAAACTGAAGATATAAACTTTAATCCAAATAACTCC
AATAAACCAACAAATAGTTCTTATAAAATTCAAACAATAAACTTAGAGAATAACAATCTA
GGTGAAAATACTTCGCAATAGACTTCAACAATTAAAAAAAATATCAATAGCAACAATTAG
AATTCTATTATAGAAACAACCTATTAGCAAGATAAATTCATAAATGGTGCAATAATTGCA
ATTAGGTCTCAAAATCTAGCTGTTAAGTATATTGTTGACCATATTAAGGAAATAACAGAC
AGAAATTTGTCTGAAGCTTATGTAAGAAAGATATGGGATCATTGGCTTAAATACAAAGAT
ATTTACTTCTCTTCAACACATAAAACAAGACTCTACACAAAGCATGAAGCCATTCAACTT
TATGATGCTATTTTTAAGCAATATAATCCAACTAACTAATCTTAAAGTATTATCCCTAAA
ATCAAAGAAGTATTGTAAAAACATGCTATAACAAAAAAATTGTTTATCAACTACTCACAA
TTCGAAGAAGTCAAAGGACTAGATACTGAAGAAACATATCTCTCAATTAAAGAAGCTATA
GACTCAGGTTAGTAATCTGATGAGCCAAAATGGATTGATGTCAGTGTAAGAATGATGATT
TCAGCAAGCTAGTTTGAATACAAGAAACAGATTGAAATTCAATGTTTTAATAAACTTAAA
AATTATTTGCAATTTTCTTGTATATAATTGGTTGGTGTAGTTATGGGTGAAACACTTAAT
GGAAGAGGAAAATTCATTTATATCCATTGTAGATATGATCAGTTAATACTAAAGAGGAAC
AAGTACTTGAAAAGATTCTTGCTTGAAGTTATTCCTGACTGGTTTTATTCTTATAACTGT
GTGCATAGTCAAAAAATTGCTATTTTTAAGTACTCTAAATTTTTATATCTCTAACGCAAG
ATACTTGAGGAGTAAGAAAGAAAAAGATTTATTCCTAATCCAGTCAATCCTCAGATAAAT
CAAACCAATCGTTTTAACAATTCTAGTGCTATAAATACCTCCCTTAACATTTCCTATCAA
TCATCTGCTGTTCCTAATACGAGTAGTATACCTCTGAACAGTTTATTCTGA


>TTHERM_00675850(protein)
MKSHSKKYQVTNNLDADNELYPQSQIQSSNNDQQTQLNSQEENNPDMIETEDINFNPNNS
NKPTNSSYKIQTINLENNNLGENTSQQTSTIKKNINSNNQNSIIETTYQQDKFINGAIIA
IRSQNLAVKYIVDHIKEITDRNLSEAYVRKIWDHWLKYKDIYFSSTHKTRLYTKHEAIQL
YDAIFKQYNPTNQSQSIIPKIKEVLQKHAITKKLFINYSQFEEVKGLDTEETYLSIKEAI
DSGQQSDEPKWIDVSVRMMISASQFEYKKQIEIQCFNKLKNYLQFSCIQLVGVVMGETLN
GRGKFIYIHCRYDQLILKRNKYLKRFLLEVIPDWFYSYNCVHSQKIAIFKYSKFLYLQRK
ILEEQERKRFIPNPVNPQINQTNRFNNSSAINTSLNISYQSSAVPNTSSIPLNSLF


>TTHERM_00675850(gene)
ATGAAATCTCATTCAAAGAAATACCAAGTAACAAATAATTTAGATGCTGACAATGAATTA
TATCCTCAATCACAAATTTAGAGTTCCAATAATGATTAGTAAACTCAACTGAACAGTCAA
GAAGAAAATAACCCTGATATGATTGAAACTGAAGATATAAACTTTAATCCAAATAACTCC
AATAAACCAACAAATAGTTCTTATAAAATTCAAACAATAAACTTAGAGAATAACAATCTA
GGTGAAAATACTTCGCAATAGACTTCAACAATTAAAAAAAATATCAATAGCAACAATTAG
AATTCTATTATAGAAACAACCTATTAGCAAGATAAATTCATAAATGGTGCAATAATTGCA
ATTAGGTCTCAAAATCTAGCTGTTAAGTATATTGTTGACCATATTAAGGAAATAACAGAC
AGAAATTTGTCTGAAGCTTATGTAAGAAAGATATGGGATCATTGGCTTAAATACAAAGAT
ATTTACTTCTCTTCAACACATAAAACAAGACTCTACACAAAGCATGAAGCCATTCAACTT
TATGATGCTATTTTTAAGCAATATAATCCAACTAACTAATCTTAAAGTATTATCCCTAAA
ATCAAAGAAGTAATTATCAAAAAATCTTATTTTAACTAAAAATTATATCCCTTTTGTTTT
TTTAAAACAATCTAGGTATTGTAAAAACATGCTATAACAAAAAAATTGTTTATCAACTAC
TCACAATTCGAAGAAGTCAAAGGACTAGATACTGAAGAAACATATCTCTCAATTAAAGAA
GCTATAGACTCAGGTTAGTAATCTGATGAGCCAAAATGGTATTTGCTTTTTATAATTTTT
ATCTATTTTAAGTGTTGTGTTTTTTTATGTTAAATTATTAAATAATTTTCATTTTAAATT
TAGGATTGATGTCAGTGTAAGAATGATGATTTCAGCAAGCTAGTTTGAATACAAGAAACA
GATTGAAATTCAATGTTTTAATAAACTTAAAAATTATTTGCAATTTTCTTGTATATAATT
GGTTGGTGTAGTTATGGGTGAAACACTTAATGGAAGAGGAAAATTCATTTATATCCATTG
TAGATATGATCAGTTAATACTAAAGAGGAACAAGTACTTGAAAAGATTCTTGCTTGAAGT
TATTCCTGACTGGTTTTATTCTTATAACTGTGTGCATAGTCAAAAAATTGCTATTTTTAA
GTACTCTAAATTTTTATATCTCTAACGCAAGATACTTGAGGAGTAAGAAAGAAAAAGATT
TATTCCTAATCCAGTCAATCCTCAGATAAATCAAACCAATCGTTTTAACAATTCTAGTGC
TATAAATACCTCCCTTAACATTTCCTATCAATCATCTGCTGTTCCTAATACGAGTAGTAT
ACCTCTGAACAGTTTATTCTGA