Identifiers and Description

Gene Model Identifier

TTHERM_00569290

Standard Name

LIA2 (localized in macronuclear anlagen 2)

Aliases

PreTt10459 | 76.m00161 | 3810.m02020 | DRH3

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00569290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03481.19.997093137033517e-262DEAD/DEAH box helicase (588 aa
)
DictyBaseDDB_G02931689.997105718980434e-168ddx17 on chromosome: 6 positio
n 2360817 to 2364250
SGDYNL112W6.998455025673696e-155DBP2 Essential ATP-dependent R
NA helicase of the DEAD-box pr
otein family, involved in nons
ense-mediated mRNA decay and r
RNA processing
OxytrichaContig21312.0.g803.9992399120784785e-154DEAD/DEAH box helicase
WormBaseWBGene000102605.997411300273806e-139locus:ddx-17 status:Confirme
d UniProt:Q9XUW5 protein_i
d:CAB04518.1
Stentor CoeruleusSteCoe_126031.7785284761271306e-68

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27793833: McDaniel SL, Zweifel E, Harris PK, Yao MC, Cole ES, Chalker DL (2016) DRH1, a p68-related RNA helicase gene, is required for chromosome breakage in Tetrahymena. Biology open 5(12):1790-1798
  2. Ref:27892853: Hamilton EP, Kapusta A, Huvos PE, Bidwell SL, Zafar N, Tang H, Hadjithomas M, Krishnakumar V, Badger JH, Caler EV, Russ C, Zeng Q, Fan L, Levin JZ, Shea T, Young SK, Hegarty R, Daza R, Gujja S, Wortman JR, Birren BW, Nusbaum C, Thomas J, Carey CM, Pritham EJ, Feschotte C, Noto T, Mochizuki K, Papazyan R, Taverna SD, Dear PH, Cassidy-Hanley DM, Xiong J, Miao W, Orias E, Coyne RS (2016) Structure of the germline genome of Tetrahymena thermophila and relationship to the massivel
  3. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00569290(coding)
ATGTGGGGAAATAGCTACAATAATAATAGTTCTAGTAATGGATACTCAAATAACAAAAGC
AACGGATATTCAAGCAGCAATAATAATGGAAACTCCTATGGAACCGGTGGCAAGTGGAAT
GATAACGGAGTTGGTTAAAATTTGGCTGCAATCGATTGGACAAAAGAAAATCTTACTACA
TTTTAGAAAGTTTTTTATAAGGAAAGTTAGAAAATAAGAACTGAAGAAGAAATCGAAGAA
TTTTACCGCCAGAACCACATCTCAGCCAAATCACCTCATGGAAAAGTACCTGACCCTTTT
TTAAGCTGGACAGATACTCACTTCCCTTAATATATTATGAATGAAGTTACTCACGCTAAA
TTTGAAAAACCCTCTCCTATTTAGTCTTTAGCATTCCCTGTAGTCCTTAGTGGTCACGAT
TTGATTGGTATTGCAGAAACAGGTAGTGGAAAAACTCTTTCCTTCCTTTTACCCTCAATA
GTTCATATTAATGCTCAACCAACTGTCAAAAAGGGAGATGGTCCTATCGTCCTCGTTCTT
GCTCCTACTAGAGAACTTGCTATGCAAATCGAAAGAGAGTCCGAAAGATTTGGTAAATCC
TCTAAGCTTAAATGTGCTTGTATCTATGGTGGTGCTGACAAATACTCCTAAAGAGCACTT
CTCCAATAAGGTGTAGATGTAGTTATTGCTACTCCTGGTAGACTTATTGACTTTTTAGAA
AGTGAAACTACTACTTTACGTAGAGTTACTTATCTCGTATTAGATGAAGCAGATAGAATG
TTAGATATGGGTTTTGAAATTTAAATTAGAAAAATCTTGGGTTAAATTAGACCTGATCGT
TAAACATTGATGTTTTCTGCTACCTGGCCTAAGAATGTTTAGAATCTTGCTTAAGATTAT
TGCAAGAATACTCCCGTTTATGTTCAAATCGGAAAACATGAATTAGCTATTAACGAAAGA
ATTAAATAAATTGTTTATGTTACAGATCAATCAAAGAAAATCAATCAACTTATCAAGCAA
TTAGATTGTTTGACTTAGAAAGATAAAGTATTGATTTTCGCTTAAACAAAGAAGGGATGT
GAAAGCATGAGTCGTATTTTGAATAAAGAAGGATTTAAGTGTCTTGCTATCCATGGTGAC
AAAGCCTAAAAAGACAGAGACTATGTTATGAACAAGTTCAAAAGCGGAGAATGCAGAATC
CTTATTGCTACAGACGTAGCCAGTAGAGGTTTGGATGTTAAGGATGTCTCCCACGTATTT
AATTACGATTTCCCAAAGGTTATGGAAGACTATGTCCATAGAATCGGTAGAACAGGTAGA
GCTGGAGCATATGGTTGTGCAGTATCTTTCCTTACTTTTGAAGATGATAAAAAGATATCA
AGGGAATATGTCCAAATGCTTCATGACGCTAAGTAAGAAATTCCCATTGATCTTCTTGAT
CTTGCTAATCCCAGATACAGAACTTAATATAAAACTGTTTCCTCTTCATACTATGATATT
AAGAAATTTAACAGTGCTGATACTTCAAAGCCTTCAGAAAATCAGAATGTTTCAAATACT
GCAAATAGCAGCGACAAGTACACCAGCAGTAGCAGCTACAATTAATATAAAAGCAAAAAA
GATGAAGATGACAAGAGAAGTAGAAGTAGAAGTCCATATAAATCTGAAAATAACAACAGA
TGGGATAAATATAATCGCACAAAAAGCCCAGAATACCGCAGTTCTAATGGATCTTCTCAT
TATAACAACGTTAACAAGTATTCTTCAAATTCTAATAATAATTCAAGTTCATATTCAAAG
AATTAATCCTCCACATCATCATCTTCTTCCTATGGATAGAATAATTAATCATCCAATTTA
ATGAGTAAACCATCTAGTAAATTCTCTGCTCCTACAAATGGTAGTTACACAAATGGATTT
TCTTCAGTCTAATAAAATTCTCAAGTTTAAAATCCATTTATGCCAATCAATCCTTTACCT
CAACCTTTTATGTACTAAATTCCTGGATTTAATGGTTTCCCTAATCAAGGTTTCAATAAC
TTTTACACTGGTATGGTTCCTCCTCCTCCACTCCCTACTGGTGCTCCCTCATAATAATAA
AATGGATTTGCTTAAAATACAACAACATCTTCTTGA


>TTHERM_00569290(protein)
MWGNSYNNNSSSNGYSNNKSNGYSSSNNNGNSYGTGGKWNDNGVGQNLAAIDWTKENLTT
FQKVFYKESQKIRTEEEIEEFYRQNHISAKSPHGKVPDPFLSWTDTHFPQYIMNEVTHAK
FEKPSPIQSLAFPVVLSGHDLIGIAETGSGKTLSFLLPSIVHINAQPTVKKGDGPIVLVL
APTRELAMQIERESERFGKSSKLKCACIYGGADKYSQRALLQQGVDVVIATPGRLIDFLE
SETTTLRRVTYLVLDEADRMLDMGFEIQIRKILGQIRPDRQTLMFSATWPKNVQNLAQDY
CKNTPVYVQIGKHELAINERIKQIVYVTDQSKKINQLIKQLDCLTQKDKVLIFAQTKKGC
ESMSRILNKEGFKCLAIHGDKAQKDRDYVMNKFKSGECRILIATDVASRGLDVKDVSHVF
NYDFPKVMEDYVHRIGRTGRAGAYGCAVSFLTFEDDKKISREYVQMLHDAKQEIPIDLLD
LANPRYRTQYKTVSSSYYDIKKFNSADTSKPSENQNVSNTANSSDKYTSSSSYNQYKSKK
DEDDKRSRSRSPYKSENNNRWDKYNRTKSPEYRSSNGSSHYNNVNKYSSNSNNNSSSYSK
NQSSTSSSSSYGQNNQSSNLMSKPSSKFSAPTNGSYTNGFSSVQQNSQVQNPFMPINPLP
QPFMYQIPGFNGFPNQGFNNFYTGMVPPPPLPTGAPSQQQNGFAQNTTTSS


>TTHERM_00569290(gene)
GTCTTTTTTAGAAGTAATATTGGGAGCTTAAAAATAAAAAGAAATAGATCCGAATTTAAT
AATTTGTAATTATCTAAAAAGAATTTTAATAGAAATAATTAATTAATTAATAAATAAATA
ATAAGAACGATACAAATAACATTCAATTAAATTAAGAAAGATAAAGCAGTACATCAAAAA
AGTAAAATGTGGGGAAATAGCTACAATAATAATAGTTCTAGTAATGGATACTCAAATAAC
AAAAGCAACGGATATTCAAGCAGCAATAATAATGGAAACTCCTATGGAACCGGTGGCAAG
TAATATTTCTATTTCACTTTTCTTAAATTTTCTTATCTCTCTTAGCTCCTTTTAGGCTAA
GAGCTTAGCAAGATATTTAAATCAAAGTCTGGGACAATGATTTGAAACATTTCTATTTAA
AAATTAGGTGGAATGATAACGGAGTTGGTTAAAATTTGGCTGCAATCGATTGGACAAAAG
AAAATCTTACTACATTTTAGAAAGTTTTTTATAAGGAAAGTTAGAAAATAAGAACTGAAG
AAGAAATCGAAGAATTTTACCGCCAGAACCACATCTCAGCCAAATCACCTCATGGAAAAG
TACCTGACCCTTTTTTAAGCTGGACAGATACTCACTTCCCTTAATATATTATGAATGAAG
TTACTCACGCTAAATTTGAAAAACCCTCTCCTATTTAGTCTTTAGGTATTGTTTGATTGA
ATTTAAACCAACAAACCAACCTACGATGGAACATTTTGAAACATAAATAAATAAATAAAA
ACCTACACACATAGTTTGTTTAAAATATATTTGCAAAAAATAAACATTTAAACAAGCCAA
TTTCTACACTTAGCATACAAAATTCAAATCACAAACGAGTGTGTGTAATTTAATTAACAA
TATATATCAATGCGGGAATCAATCAATCAATGTTAAGAAGAAGCCAAAGGTTATTCCTTA
AGAATAAGCATCGCTCAATGTTTCCAAAGAGACCAATGTATTTATTCAATATGAATCTAC
TTGAATAAAGGTGAATTTATTCTTTCTGAGGGAATTATTGATCGAAGTGCTTATCATCCT
CATTCTTAATATTGTTTGTACAGCAGATTATTATCAGGAGGAGAACGAAATGGATCCAAA
AAAGATAATCAGAGCTGAATGTAACTGTACTGTCATTTATCTTTTTGATTCATTTCAATT
CTCTTGAAAAACTGCATTTTCCCTTCAGAATTTTGATTTTCAAATCAATCATCCATTCTA
TTTCACATTTCCATCTTAAAAAAGAAACAATCATCCCCGTCATTTATTTATTCCTTACAG
CCAACAAATTTCATTTATAAACTTATATTTATTTTAATAATCCTTCAGTATAACCATATA
ATTTGGCTTTTTTGCTAAATTTTAAACACAAATCAATCAATCAATCAAAAATAAATTTAA
ATAGGATAGACAGATGTATCAATTTGCATATATTTAAAATAAATAGCCTTTGCAAATTTT
CAAATTTGCTTTATTATATAATTAATTTGTCTAATAACTTTAATCTAATTTTTTTTTTTT
TCATTATTGATTGATAGAGGATTGACAAACAAAATTATCTTTTTTTTAAACAAATAATGA
AATTTACAAGAGTTTGAAAAATCAAATTCTAAAGGGAAAATTATTTTTATCGCTCAATAT
TGTTTCTTTTCATTATAGATTATTTTATCAAAAGCTCTATTTATTGGAAAAATTTACTTA
CCAATTTATAGCTGATTAATAATTACTACTCACAAATGATTAAATATTTATAAGTTTGAT
TTTCCCTAAAATTAACTAGCATTCCCTGTAGTCCTTAGTGGTCACGATTTGATTGGTATT
GCAGAAACAGGTAGTGGAAAAACTCTTTCCTTCCTTTTACCCTCAATAGTTCATATTAAT
GCTCAACCAACTGTCAAAAAGGGAGATGGTCCTATCGTCCTCGTTCTTGCTCCTACTAGA
GAACTTGCTATGCAAATCGAAAGAGAGTCCGAAAGATTTGGTAAATCCTCTAAGCTTAAA
TGTGCTTGTATCTATGGTGGTGCTGACAAATACTCCTAAAGAGCACTTCTCCAATAAGGT
GTAGATGTAGTTATTGCTACTCCTGGTAAATATATATCAACATTTGAACACTTTTAACCA
ACTTTCAAATAAATTTCTTAAATTAAACTTTTTTTTAATTTAAATTACAGGTAGACTTAT
TGACTTTTTAGAAAGTGAAACTACTACTTTACGTAGAGTTACTTATCTCGTATTAGATGA
AGCAGATAGAATGTTAGATATGGGTTTTGAAATTTAAATTAGAAAAATCTTGGGTTAAAT
TAGACCTGATCGTTAAACATTGATGTTTTCTGCTACCTGGCCTAAGAATGTTTAGAATCT
TGCTTAAGATTATTGCAAGAATACTCCCGTTTATGTTCAAATCGGAAAACATGAATTAGC
TATTAACGAAAGAATTAAATAAATTGTTTATGTTACAGATCAATCAAAGAAAATCAATCA
GTATTTAAATATTTTAACAATTATTTTTTCAATTATCTAAATATTCTTTTTTAATTAATA
GACTTATCAAGCAATTAGATTGTTTGACTTAGAAAGATAAAGTATTGATTTTCGCTTAAA
CAAAGAAGGGATGTGAAAGCATGAGTCGTATTTTGAATAAAGAAGGATTTAAGTGTCTTG
CTATCCATGGTGACAAAGCCTAAAAAGACAGAGACTATGTTATGAACAAGTTCAAAAGCG
GAGAATGCAGAATCCTTATTGCTACAGACGTAGCCAGTAGAGGTTTGGATGTTAAGGATG
TCTCCCACGTATTTAATTACGATTTCCCAAAGGTTATGGAAGACTATGTCCATAGAATCG
GTAGAACAGGTAGAGCTGGAGCATATGGTTGTGCAGTATCTTTCCTTACTTTTGAAGATG
ATAAAAAGATATCAAGGGAATATGTCCAAATGCTTCATGACGCTAAGTAAGAAATTCCCA
TTGATCTTCTTGATCTTGCTAGTATTAGTAATTATTTATTAATATGAATTCAATTCTAAA
TTTTTTACTTAAATAAAATAGATCCCAGATACAGAACTTAATATAAAACTGTTTCCTCTT
CATACTATGATATTAAGAAATTTAACAGTGCTGATACTTCAAAGCCTTCAGAAAATCAGA
ATGTTTCAAATACTGCAAATAGCAGCGACAAGTACACCAGCAGTAGCAGCTACAATTAAT
ATAAAAGCAAAAAAGATGAAGATGACAAGAGAAGTAGAAGTAGAAGTCCATATAAATCTG
AAAATAACAACAGATGGGATAAATATAATCGCACAAAAAGCCCAGAATACCGCAGTTCTA
ATGGATCTTCTCATTATAACAACGTTAACAAGTATTCTTCAAATTCTAATAATAATTCAA
GTTCATATTCAAAGAATTAATCCTCCACATCATCATCTTCTTCCTATGGATAGAATAATT
AATCATCCAATTTAATGAGTAAACCATCTAGTAAATTCTCTGCTCCTACAAATGGTAGTT
ACACAAATGGATTTTCTTCAGTCTAATAAAATTCTCAAGTTTAAAATCCATTTATGCCAA
TCAATCCTTTACCTCAACCTTTTATGTACTAAATTCCTGGATTTAATGGTTTCCCTAATC
AAGGTTTCAATAACTTTTACACTGGTATGGTTCCTCCTCCTCCACTCCCTACTGGTGCTC
CCTCATAATAATAAAATGGATTTGCTTAAAATACAACAACATCTTCTTGA