Identifiers and Description

Gene Model Identifier

TTHERM_00675900

Standard Name

LIA1 (localized in macronuclear anlagen 1)

Aliases

PreTt11031 | 101.m00186

Description

nuclear protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07609 ) conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 24.4%

TetraMine Data

TTHERM_00675900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41180.11.0000099287337047e-53Lia1p (127 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17586719: Rexer CH, Chalker DL (2007) Lia1p, a novel protein required during nuclear differentiation for genome-wide DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 6(8):1320-9
  2. Ref:17519286: Yao MC, Yao CH, Halasz LM, Fuller P, Rexer CH, Wang SH, Jain R, Coyne RS, Chalker DL (2007) Identification of novel chromatin-associated proteins involved in programmed genome rearrangements in Tetrahymena. Journal of cell science 120(Pt 12):1978-89

Sequences

>TTHERM_00675900(coding)
ATGACAGGAAAAAAATAACAACCTGTTAAGGGTTTTAATGTTAAAGGTATGATTTTGGCT
TTAAAAGGTTTCGGTTTAAGTCATGGACTAGTTATGAGAACAATGGAAAAATTAGGATTG
CCTATCTCATATAATTTGATTACTGAAACTATGACCAACTGGAAAAATGATTAGTTAGTT
GGAAACTTGGATTTAAAAAAATACCTTGATTTAATGGAATTGAGAAGAACTGATCCTGAC
GCATATTATAAAAAGCTCAATACTTACAAAAGAGATAAATTAGAAACTCGAAATTCTAAA
TGGAAAAATAAGGTTTTTAGTCTATAAAATGTTTTAAGTACAAGCAAACTTTCATCATCA
AGCAATAATTAGAATTCCTAATTACTCAGCAAGAAGTAAAAAAGCATGCAAAGTATCTCT
CCTCATAAACTTAGACATGAAAATCACCAATAAAAACAATTTAATTCAAATATTGTCAGC
ATCTCTTAGAAAAAAATGAGTTTTGAACGTGATTCAGATTTTGAAGATCTCCAATCAGAA
TCAGGAGAAGATGATTTTCGTGTTTTTGACTAAAAATATATTAAAAAATCTGATTTTGGC
AAATTAGATAAAAATCACTCTAAAATAATGCATGGTTCATCAACAAAAATTATTCCTAAA
TTGAAAATTATAAGTAAGAGGCCAAATAAATTTTAATGA


>TTHERM_00675900(protein)
MTGKKQQPVKGFNVKGMILALKGFGLSHGLVMRTMEKLGLPISYNLITETMTNWKNDQLV
GNLDLKKYLDLMELRRTDPDAYYKKLNTYKRDKLETRNSKWKNKVFSLQNVLSTSKLSSS
SNNQNSQLLSKKQKSMQSISPHKLRHENHQQKQFNSNIVSISQKKMSFERDSDFEDLQSE
SGEDDFRVFDQKYIKKSDFGKLDKNHSKIMHGSSTKIIPKLKIISKRPNKFQ


>TTHERM_00675900(gene)
ATGACAGGAAAAAAATAACAACCTGTTAAGGGTTTTAATGTTAAAGGTATGATTTTGGCT
TTAAAAGGTTTCGGTTTAAGTCATGGACTAGTTATGAGAACAATGGAAAAATTAGGATTG
CCTATCTCATATAATTTGATTACTGAAACTATGACCAACTGGAAAAATGATTAGTTAGTT
GGAAACTTGGATTTAAAAAAATACCTTGATTTAATGGAATTGAGAAGAACTGATCCTGAC
GCATATTATAAAAAGCTCAATACTTACAAAAGAGATAAATTAGAAACTCGAAATTCTAAA
TGGAAAAATAAGGTTTTTAGTCTATAAAATGTTTTAAGTACAAGCAAACTTTCATCATCA
AGCAATAATTAGAATTCCTAATTACTCAGCAAGAAGTAAAAAAGCATGCAAAGTATCTCT
CCTCATAAACTTAGACATGAAAATCACCAATAAAGTATCAATTAAATTACTTTCTAAAAA
TTAATGAATAAAAAATGCTTTTTTAAATAAAAGAACAATTTAATTCAAATATTGTCAGCA
TCTCTTAGAAAAAAATGAGTTTTGAACGTGATTCAGATTTTGAAGATCTCCAATCAGAAT
CAGGAGAAGATGATTTTCGTGTTTTTGACTAAAAATATATTAAAAAATCTGATTTTGGCA
AATTAGATAAAAATCACTCTAAAATAATGCATGGTTCATCAACAAAAATTGTAAAAAATT
AATTTATTTTTTAAAGTTATTTAGTTAAAAATTTTTTAAATAAACAAACAAATCTAGATT
CCTAAATTGAAAATTATAAGTAAGAGGCCAAATAAATTTTAATGA