Identifiers and Description

Gene Model Identifier

TTHERM_00971840

Standard Name

LC8E (Light chain subunit of dynein )

Aliases

PreTt01454 | 180.m00074 | 3749.m00272 | LC8F

Description

Light chain subunit of dynein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00971840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20007.15.002115178225629e-63dynein light chain type 1 fami
ly protein (94 aa)
WormBaseWBGene000010054.998021988471165e-24locus:dlc-1 Dynein light cha
in 1, cytoplasmic status:Con
firmed UniProt:Q22799 prot
ein_id:CCD63216.1
OxytrichaContig20780.0.g1061.9994498063102785e-22Dynein light chain type 1
DictyBaseDDB_G02748151.000361553249356e-16dlcB on chromosome: 2 position
3974977 to 3975525
SGDYDR424C1.000361553249356e-16DYN2 Cytoplasmic light chain d
ynein, microtubule motor prote
in; proposed to be involved in
the assembly of the nuclear p
ore complex

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00971840(coding)
ATGGGAGATCATGCAAACGAATAAATTATTGACATGCCTGAAAATTCAGAAATGAAAAGC
ATGAAAAATGATGCCTTTTCTTAAGCTAAATTCGCAGTTGAAAATTATAAATTTGAAAAT
AAAATATCATCTCATATAAAGAAATTCTTTGATGAGAAGTATGGACCAAATTGGCATTGT
GTTGTTGGTAAGCACTTCAATGCTTATGTATCATATGATAGCAAAAACTTTATATTCTTT
TACGAGGGTTAATTAGCTATTCTTTTATATAGAAAAGGTTGA


>TTHERM_00971840(protein)
MGDHANEQIIDMPENSEMKSMKNDAFSQAKFAVENYKFENKISSHIKKFFDEKYGPNWHC
VVGKHFNAYVSYDSKNFIFFYEGQLAILLYRKG


>TTHERM_00971840(gene)
ATGGGAGATCATGCAAACGAATAAATTATTGACATGCCTGAAAATTCAGAAATGAAAAGC
ATGAAAAATGATGCCTTTTCTTAAGTAAATAGCTAAATGATTGATAAAAATAAATAAATT
TCATTTTTAAAAGGATTTAATATTGTTTAGATTAATTTTATTAGCCATCTTTAACTCAAG
AGTAGTCATTTAAACTAATATATTTTATAATAAAAAGGCTAAATTCGCAGTTGAAAATTA
TAAATTTGAAAATAAAATATCATCTCATATAAAGAAATTCTTTGATGAGAAGTATGGACC
AAATTGGCATTGTGTTGTTGGTAAAATAGCTTAGCTTAAAATTAAAAATAGGTTTTTTGA
AATTAATAATTTTTTTTTAATATAAAGGTAAGCACTTCAATGCTTATGTATCATATGATA
GCAAAAACTTTATATTCTTTTACGAGGGTTAATTAGCTATTCTTTTATATAGAAAAGGTT
GA