Identifiers and Description

Gene Model Identifier

TTHERM_00030210

Standard Name

LC7B

Aliases

PreTt14252 | 2.m02399 | 3825.m02639

Description

Dynein light chain 2B, cytoplasmic, putative, Light chain subunit of ciliary three-headed outer arm dynein (OAD), two-headed inner arm dynein (IAD) complex 1, and non-axonemal dynein complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00030210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00811.14.001968334034435e-68dynein light chain 2B, cytopla
smic (104 aa)
OxytrichaContig16690.0.g702.999534586690157e-23Roadblock/LC7 domain
WormBaseWBGene000120044.997543945741262e-17locus:dyrb-1 status:Confirme
d UniProt:Q22752 protein_i
d:CAA90946.1
DictyBaseDDB_G02858550.000000000000020000882446601127dlcC on chromosome: 4 position
3725623 to 3726100

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00030210(coding)
ATGATCTATAAAACTTCAAAAGAAATTTAAAAGAGTGACTAAAGAATAATTTAATAAAGA
GTAGAGAATTCAATTATTAATAATCAAATATATCAAAAATCTCTTAAGCGAAAAACAAGC
AAAAGAAAAGTAAGGCACTAAGCAAACAAAAAAAATTTTTAAAAAGAAATGTCTGAAGTT
GAGGATACTTTAAATAGAATAAAGACACATAAAACAGTTTTAGGCTACTTGATTGTTAAT
AGTGAAGGTGGTGTTGTTAGAGGTGCCTTTAAGGATGAGGAAGAAAGCAAAAATATCGCA
AATTCAATTCCTCTACTCACAAAAAAGGCTCGCTCTGTTGTAAGAGACTTAGACCCTACA
AATGATTTAGTTTTCTTGCGTATATAAACTAAGCTTAATGAGATTATGGTTGCTCCTGAT
GATGAATTCTCTTTAATCGTAATATAAACTAAAGGTGAAAAGCGTGATGAAAACGATTGA


>TTHERM_00030210(protein)
MIYKTSKEIQKSDQRIIQQRVENSIINNQIYQKSLKRKTSKRKVRHQANKKNFQKEMSEV
EDTLNRIKTHKTVLGYLIVNSEGGVVRGAFKDEEESKNIANSIPLLTKKARSVVRDLDPT
NDLVFLRIQTKLNEIMVAPDDEFSLIVIQTKGEKRDEND


>TTHERM_00030210(gene)
ATGATCTATAAAACTTCAAAAGAAATTTAAAAGAGTGACTAAAGAATAATTTAATAAAGA
GTAGAGAATTCAATTATTAATAATCAAATATATCAAAAATCTCTTAAGCGAAAAACAAGC
AAAAGAAAAGTAAGGCACTAAGCAAACAAAAAAAATTTTTAAAAAGAAATGTCTGAAGTT
GAGGATACTTTAAATAGAATAAAGACACATAAAACAGTTTTAGGCTACTTGATTGTTAAT
AGTGAAGGTGGTGTTGTTAGAGGTGCCTTTAAGGATGAGGAAGAAAGCAAAAATATCGCA
AATTCAATTCCTCTACTCACAAAAAAGGCTCGCTCTGTTGTAAGAGACTTAGACCCTACA
AATGATTTAGTTTTCTTGCGTATATAAACTAAGCTTAATGAGATTATGGTTGCTCCTGAT
GATGAATTCTCTTTAATCGTAATATAAACTAAAGGTGAAAAGCGTGATGAAAACGATTGA