Identifiers and Description

Gene Model Identifier

TTHERM_00152040

Standard Name

LC7A

Aliases

PreTt20862 | 12.m00536 | 3700.m00255

Description

Light chain subunit of ciliary three-headed outer arm dynein (OAD), two-headed inner arm dynein (IAD) complex 1, and non-axonemal dynein complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00152040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05152.15.999140071902665e-66dynein light chain 2B, cytopla
smic (106 aa)
OxytrichaContig16690.0.g708.001486403440551e-25Roadblock/LC7 domain
WormBaseWBGene000120044.999245259173412e-21locus:dyrb-1 status:Confirme
d UniProt:Q22752 protein_i
d:CAA90946.1
DictyBaseDDB_G02858551.999598840915195e-17dlcC on chromosome: 4 position
3725623 to 3726100

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00152040(coding)
ATGTCTGAAGTTGAAGAAACCCTTAATAGAATCAAAACCCATAAATCAGTTTAAGGAATT
GTTATCGTTAATAATGAAGGTAATATTATCAGAACCACATATGAAGGAGATTAAAAAAGT
TTAGGTGAAAAGATTGCCATTAACATACCTTAATTGGCAGCTAAGGCAAAATCTACTGTC
AGAGATCTTGATGAGAATAATCATTTAGTATTTCTGAGAATTAAATCTGATCGTAACGAA
ATAATGGTTGCCCCTGATAAAGATTTTATGCTTATAGTTGTTTAAGGTAAAAGTGATAAA
AAGGAAGATGCTGATTGA


>TTHERM_00152040(protein)
MSEVEETLNRIKTHKSVQGIVIVNNEGNIIRTTYEGDQKSLGEKIAINIPQLAAKAKSTV
RDLDENNHLVFLRIKSDRNEIMVAPDKDFMLIVVQGKSDKKEDAD


>TTHERM_00152040(gene)
ATGTCTGAAGTTGAAGAAACCCTTAATAGAATCAAAACCCATAAATCAGTTTAAGGAATT
GTTATCGTTAATAATGAAGGTAATATTATCAGAACCACATATGAAGGAGATTAAAAAAGT
TTAGGTGAAAAGATTGCCATTAACATACCTTAATTGGCAGCTAAGGCAAAATCTACTGTC
AGAGATCTTGATGAGAATAATCATTTAGTATTTCTGAGAATTAAATCTGATCGTAACGAA
ATAATGGTTGCCCCTGATAAAGATTTTATGCTTATAGTTGTTTAAGGTAAAAGTGATAAA
AAGGAAGATGCTGATTGA