Identifiers and Description

Gene Model Identifier

TTHERM_01075620

Standard Name

LC4A (Light chain subunit of ciliary three-headed outer ... )

Aliases

PreTt02674 | 219.m00027

Description

Light chain subunit of ciliary three-headed outer arm dynein (OAD)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01075620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15342.11.9992560499818233e-109EF hand family protein (161 aa
)
OxytrichaContig22680.0.g501.0002335610448659e-38EF hand
Stentor CoeruleusSteCoe_50947.781132241133797e-20
SGDYBR109C0.000000000000001999258566166494CMD1 Calmodulin; Ca++ binding
protein that regulates Ca++ in
dependent processes (mitosis,
bud growth, actin organization
, endocytosis, etc.) and Ca++
dependent processes (stress-ac
tivated pathways), targets inc
lude Nuf1p, Myo2p and calcineu
rin
WormBaseWBGene000005520.00000000000004998767099442072locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
DictyBaseDDB_G02794070.0000000000008001317446409227calA on chromosome: 3 position
2244074 to 2245039

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01075620(coding)
ATGGCGAGTGAAGTTATGAACTTATCTGAAGAAGATATCTAGTTCTGCCAGAAAGCTTTC
TCTGATTATGATGAAGATGGATTAGGAGCTATTAAGGTTTCTGATTTGAAGCTTGCTTTA
GAGAATATAGGATGTTCTCTTAGCGAAAACGATTTATTTAAAATGATTAGTGAGGTTGAT
GAGAAGAATACAGGTCTCATCAAGTTTTCTGATTTTTTGAATATTTATTACAAATAAAAA
TATGCAAATCTTGGAGATGATGATTAGGATTTAGTTGATGCTTTTGTGGCTATGGGCGGT
AATGCCGATACCACAGGCTCCGTAGATGCAAACCGTCTCATATAAATAGTAAAAGAAGAG
TTCGAAATGACTATTGACATAGTTGGATTGATTCGTGAAATTGATAAGGATGGATCTGGA
GAAATCGAATATGAAGAATTTAAATTGCTTCTCAAATCAGGTTTTGCTAATGAGGGAAAC
TGA


>TTHERM_01075620(protein)
MASEVMNLSEEDIQFCQKAFSDYDEDGLGAIKVSDLKLALENIGCSLSENDLFKMISEVD
EKNTGLIKFSDFLNIYYKQKYANLGDDDQDLVDAFVAMGGNADTTGSVDANRLIQIVKEE
FEMTIDIVGLIREIDKDGSGEIEYEEFKLLLKSGFANEGN


>TTHERM_01075620(gene)
ATGGCGAGTGAAGTTATGAACTTATCTGAAGAAGATATCTAGTTCTGCCAGAAAGCTTTC
TCTGATTATGATGAAGATGGATTAGGAGCTATTAAGGTTTCTGATTTGAAGCTTGCTTTA
GAGAATATAGGATGTTCTCTTAGCGAAAACGATTTATTTAAAATGATTAGTGAGGTTGAT
GAGAAGAATACAGGTCTCATCAAGTTTTCTGATTTTTTGAATATTTATTACAAATAAAAA
TATGCAAATCTTGGAGATGATGATTAGGATTTAGTTGATGCTTTTGTGGCTATGGGCGGT
AATGCCGATACCACAGGCTCCGTAGATGCAAACCGTCTCATATAAATAGTAAAAGAAGAG
TTCGAAGTAAAAAATTAAATTAATTTTTTTCTTTCTCTATAATAAAGATAACTTTCATTC
AAAACTTTACAAAACAATTTGCAAAAATTTTATGATAATTGTTCAAATGTTTTTTGCTTA
TCACCTAGACCAAATCCGAATTCTTTTTTCTATAGAATTGGGTAGACCAGTGAACAAAAA
TAAATAAATATCTTTAAAATTACAAAATTAATTTCTATCTTTAATTAATAAAACTGTTTT
GATAATATTTTAGATGACTATTGACATAGTTGGATTGATTCGTGAAATTGATAAGGATGG
ATCTGGAGAAATCGAATATGAAGAATTTAAATTGCTTCTCAAATCAGGTTTTGCTAATGA
GGGAAACTGA