Identifiers and Description

Gene Model Identifier

TTHERM_00623050

Standard Name

LC3B

Aliases

PreTt07392 | 87.m00172 | 3814.m00877

Description

Light chain subunit of ciliary three-headed outer arm dynein (OAD)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.3%

TetraMine Data

TTHERM_00623050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11983.17.002411919958887e-50thioredoxin family protein (10
8 aa)
WormBaseWBGene000101600.000000000000020000882446601127locus:png-1 Peptide-N(4)-(N-
acetyl-beta-glucosaminyl)aspar
agine amidase status:Confirm
ed UniProt:Q9TW67 protein_
id:CAB04487.2
SGDYLR043C0.00000000000020009182674645818TRX1 Cytoplasmic thioredoxin i
soenzyme of the thioredoxin sy
stem which protects cells agai
nst oxidative and reductive st
ress, forms LMA1 complex with
Pbi2p, acts as a cofactor for
Tsa1p, required for ER-Golgi t
ransport and vacuole inheritan
ce
DictyBaseDDB_G02760570.0000000000019997478866288316DDB_G0276057 on chromosome: 2
position 6469384 to 6471238
OxytrichaContig15740.0.g800.00000000009998509410508463Thioredoxin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00623050(coding)
ATGTCTCATCCCTACATAGAAATTACAAGCACCAAGCAATTCGAAGATATTCTCGAAAAG
AACGAATATGTTTTAGTTGATTTCTTTGCTTCCTGGTGTGGCCCTTGCAAAATTTTAGCT
GAATAATTCGAACCTATTAAGAAAGATCACAAGAACCTAACTATTGTTAAGGTTAACATT
GACGAAGAAGATTTAGAATCTATTGTTGAATCTCACAATGTTTCTTCTCTTCCTCACGTT
TTCTTATACCACAAGAAGACTGTTGTTAAATAATTCATTGGTAACCAAAAAGACCAATTA
TGGGAAATGGCTAAACTCAGTGATGCTAAGTGA


>TTHERM_00623050(protein)
MSHPYIEITSTKQFEDILEKNEYVLVDFFASWCGPCKILAEQFEPIKKDHKNLTIVKVNI
DEEDLESIVESHNVSSLPHVFLYHKKTVVKQFIGNQKDQLWEMAKLSDAK


>TTHERM_00623050(gene)
ATGTCTCATCCCTACATAGAAATTACAAGCACCAAGCAATTCGAAGATATTCTCGAAAAG
AACGAATATGTTTTAGTTGATTTCTTTGCTTCCTGGTGTGGCCCTTGCAAAATTTTAGCT
GAATAATTCGAACCTATTAAGAAAGATCACAAGAACCTAACTATTGTTAAGGTTAACATT
GACGAAGAAGATTTAGAATCTATTGTTGAATCTCACAATGTTTCTTCTCTTCCTCACGTT
TTCTTATACCACAAGAAGACTGTTGTTAAATGTAATTTCATTTTCGACTTTAAAAGTCTA
TTAACTGATTTTAAAAAATAATTTTTAAATAATTTATAAAAATAGAATTCATTGGTAACC
AAAAAGACCAATTATGGGAAATGGCTAAACTCAGTGATGCTAAGTGA