Identifiers and Description

Gene Model Identifier

TTHERM_00561440

Standard Name

LC2B

Aliases

PreTt27905 | 74.m00182 | 3720.m00072 | Tctex2B

Description

Light chain subunit of ciliary two-headed inner arm dynein (IAD) complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00561440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16138.11.9991716194688635e-85tctex-1 family protein (129 aa
)
OxytrichaContig10748.0.g64.001416569413617e-37Tctex-1 family
WormBaseWBGene000170141.9999391735788327e-19locus:dylt-2 status:Partiall
y_confirmed UniProt:Q18917
protein_id:CCD64418.1
Stentor CoeruleusSteCoe_140970.00000000000003442477108469977
DictyBaseDDB_G02845890.000000000500206551404915dlcA on chromosome: 4 position
2178851 to 2179736

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00561440(coding)
ATGAAAAGAGGATAAGGAGGCACTACTAACTAGGAATATTAAATCCGCCCTAAATAAAGA
GAAAAATTTAGACCAGGCAAAGCAAAAGAAATAATTAGTGAAACATTAAATTTAAAATTA
AAAAACTAAGTATACACTGATGCAGCTACTGTGTCTACAATCTCTAGAGATATTGCTGAC
ACCATTAAATACAAATTAAAAGATTTAGGATTACCAAGATATAAGTTTATGGTATCAGTT
ATTATTGGATAATAAAAAGGTTAAGGTGTAAGAGTCGGATCTCGTTAATTTTGGGATTTC
GATACTGATTATGTAGCTAGTGATTATTATGTCAATGACTCACTATTTTGTCTTGTAACT
GTTTACGGCGTTTATCTTTACTGA


>TTHERM_00561440(protein)
MKRGQGGTTNQEYQIRPKQREKFRPGKAKEIISETLNLKLKNQVYTDAATVSTISRDIAD
TIKYKLKDLGLPRYKFMVSVIIGQQKGQGVRVGSRQFWDFDTDYVASDYYVNDSLFCLVT
VYGVYLY


>TTHERM_00561440(gene)
ATGAAAAGAGGATAAGGAGGCACTACTAACTAGGAATATTAAATCCGCCCTAAATAAAGA
GAAAAATTTAGACCAGGCAAAGCAAAAGAAATAATTAGTGAAACATTAAATTTAAAATTA
AAAAACTAAGTATACACTGATGCAGCTACTGTGTCTACAATCTCTAGAGATATTGCTGAC
ACCATTAAATACAAATTAAAAGATTTAGGATTACCAAGATATAAGTTTATGGTATCAGTT
ATTATTGGATAATAAAAAGGTTAAGGTGTAAGAGTCGGATCTCGTTAATTTTGGGATTTC
GATACTGATTATGTAGCTAGTGATTATTATGTCAATGACTCACTATTTTGTCTTGTAACT
GTTTACGGCGTTTATCTTTACTGA