Identifiers and Description

Gene Model Identifier

TTHERM_00334290

Standard Name

LC1

Aliases

PreTt05974 | 34.m00211 | 3689.m00009

Description

Light chain subunit of ciliary three-headed outer arm dynein (OAD)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00334290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16020.12.0000211193600847e-137leucine rich repeat family pro
tein (203 aa)
OxytrichaContig476.1.g568.001993295941272e-61Leucine Rich repeats (2 copies
)
Stentor CoeruleusSteCoe_309533.221340285992516e-27
DictyBaseDDB_G02840390.000000009996807949091551pprA on chromosome: 4 position
1595576 to 1596770
WormBaseWBGene001899520.0000000400154582995175status:Partially_confirmed U
niProt:C4ALD3 protein_id:CCD
72863.1
SGDYKL193C0.0000009995106777214876SDS22 Conserved nuclear regula
tory subunit of Glc7p type 1 p
rotein serine-threonine phosph
atase (PP1), functions positiv
ely with Glc7p to promote deph
osphorylation of nuclear subst
rates required for chromosome
transmission during mitosis

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00334290(coding)
ATGTCAAAAGGTACAACCTGTCAAAAGGCTATCGTCAACTGGGAAGCTGCTAATCCTGGT
AAAAATCCTTCTGAAGCAGAAGAAATCAAGCTAATTTTCTAAATTCCTCCTATTGAAAAG
ATGGACGGTCCCGTTTTAAACACTCTTACTAAATGCAAAAAGCTATCTTTATCTTCAAAC
TCTATCGATAAAATGATCTCTTTGAATATGCTCCGAAATTTAGAAATTTTGTCTCTGTCT
CGTAATGTCATCAAAAAGATTAGTGGTTTAGAAGATATAGGAGGAACATTAAGGCAGTTA
TGGTTAAGTTATAATTTCATTGAAAAGTTAGATGGTTTAAATAATTGCAGTGTCCTCCAG
ACCTTATATATTGGAAATAATAGAATCAAAAATTGGGAAGAATTGGATAAGCTAAAAGAT
CTTCCTGAATTAGAAAATGTGCTTTTTTATGGTAACCCAATATATGAATAAGTAAAAGAA
GATCCAAAGTTAATCGTCTTGAAAAAGTTGCCTACCTTAAAAAATGTTGATGGCTACATT
ATTGATGATTCTGTTCTCGAAAAGGTTAAATAAATTGCAGATATCCCTATTTCAGCTAAA
TAACTTTGA


>TTHERM_00334290(protein)
MSKGTTCQKAIVNWEAANPGKNPSEAEEIKLIFQIPPIEKMDGPVLNTLTKCKKLSLSSN
SIDKMISLNMLRNLEILSLSRNVIKKISGLEDIGGTLRQLWLSYNFIEKLDGLNNCSVLQ
TLYIGNNRIKNWEELDKLKDLPELENVLFYGNPIYEQVKEDPKLIVLKKLPTLKNVDGYI
IDDSVLEKVKQIADIPISAKQL


>TTHERM_00334290(gene)
ATGTCAAAAGGTACAACCTGTCAAAAGGCTATCGTCAACTGGGAAGCTGCTAATCCTGGT
AAAAATCCTTCTGAAGCAGAAGAAATCAAGCTAATTTTCTAAATTCCTCCTATTGAAAAG
ATGGACGGTCCCGTTTTAAACACTCTTACTAAATGCAAAAAGCTATCTTTATCTTCAAAC
TCTATCGATAAAATGATCTCTTTGAATATGCTCCGAAATTTAGAAATTTTGTCTCTGTCT
CGTAATGTCATCAAAAAGATTAGTGGTTTAGAAGATATAGGAGGAACATTAAGGCAGTTA
TGGTTAAGTTATAATTTCATTGAAAAGTTAGATGGTTTAAATAATTGCAGTGTCCTCCAG
ACCTTATATATTGGAAATAATAGAATCAAAAATTGGGAAGAATTGGATAAGCTAAAAGAT
CTTCCTGAATTAGAAAATGTGCTTTTTTATGGTAACCCAATATATGAATAAGTAAAAGAA
GATCCAAAGTTAATCGTCTTGAAAAAGTTGCCTACCTTAAAAAATGTTGATGGCTACATT
ATTGATGATTCTGTTCTCGAAAAGGTTAAATAAATTGCAGATATCCCTATTTCAGCTAAA
TAACTTTGA