Identifiers and Description

Gene Model Identifier

TTHERM_00600650

Standard Name

LBE1 (Lycopene Biosynthesis-Enhancing )

Aliases

PreTt22128 | 83.m00197 | LBE | 3685.m00089

Description

Lycopene biosynthesis-enhancing protein; similar to sigma cross-reacting protein 27A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00600650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14922.12.9988266274323582e-173hypothetical protein (331 aa)
Stentor CoeruleusSteCoe_178522.6102790696677047e-23
OxytrichaContig18437.0.g284.0009493637353324e-18DJ-1/PfpI family

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00600650(coding)
ATGATCGCCAGACATATTTTAAAATTATAAAATCTCGCCAAGACTACTCCTTTCTTCAGA
TTCTCTGAATTCAATGAAACTGAATCTTCTTTCAATCACAACGAAAACAGACCTTAAAGA
GTCCAAAAGCCCAGATTCAAAAAGGTTGCTATCATCCTTTCCGGTTGTGGTGTTTATGAT
GGTTCTGAAGTTACTGAAGTTGTTTCTTTGATGGTTCACTTGAATAAGAGTCATGTTTCC
TTCTAATGTTTCGCTCCTAACTAAGACCAATTGCACGTTGTTAATCACATTACTGGTGAA
ACTACCACTGAAACTAGAAACGTTTTAGTTGAATCTGCTAGAATTGCTAGAGGAGAGGTC
AAGGATATCACTTAACTTAAGGGTGAAGACTATCAAGCTGTCCTCCTTCCCGGTGGTTTC
GGTGCTGCTAAGAATCTTTCTGATTACGCTGTTAATGGTACTAACTTCACAGTTAACTCT
GAAGTCGAAAGAGTCCTTAGGGAATTCCACAGCCAAAAGAAGCCTATTGGTGCTATGTGC
ATTAGTCCTTTAATTTTAGCTAAGGTTTTACAAAACGAAAAACCTAAAATCACCATGGGT
AGAGTTGATAACCAAGACACCCCTAATAAATACTGGCCTCATAGTGAAGCTATCAATGCT
GCTGAAACATTAGGTGCTCAACATTTCCAAAGAAATGCCGATAGATTCTAAGTCGATTTC
GAAAATAAAATAGTCACTGCTCCTGCTATGATGTTTAACGGTTTCACCAAATTTTCTACT
ACTTTCGATGGAGCTGGTCACTTAGTTAACATTATTGATCAAATCGTCTAAGGTAACTCC
ATTAAGCTTGATACAATTGGTGAAAAGAAGCATGAAAATTTCGATGGTGAAAGAAGACCT
AGAGGTTAATATAATAGAAACAACAACAACAGAAGACCTAGAGAAAACAACAACGAAAAT
CACGAATAACACCATCATCACGAATAATAATGA


>TTHERM_00600650(protein)
MIARHILKLQNLAKTTPFFRFSEFNETESSFNHNENRPQRVQKPRFKKVAIILSGCGVYD
GSEVTEVVSLMVHLNKSHVSFQCFAPNQDQLHVVNHITGETTTETRNVLVESARIARGEV
KDITQLKGEDYQAVLLPGGFGAAKNLSDYAVNGTNFTVNSEVERVLREFHSQKKPIGAMC
ISPLILAKVLQNEKPKITMGRVDNQDTPNKYWPHSEAINAAETLGAQHFQRNADRFQVDF
ENKIVTAPAMMFNGFTKFSTTFDGAGHLVNIIDQIVQGNSIKLDTIGEKKHENFDGERRP
RGQYNRNNNNRRPRENNNENHEQHHHHEQQ


>TTHERM_00600650(gene)
ATGATCGCCAGACATATTTTAAAATTATAAAATCTCGCCAAGACTACTCCTTTCTTCAGA
GTAAATATCTTTGTTTTAATTTTCACTTGAAAAATCCTATTTTTAAGATTATTTATTCAA
ATTATAATTTATCTTATTTTATTTAATTATTTAATAGTTCTCTGAATTCAATGAAACTGA
ATCTTCTTTCAATCACAACGAAAACAGACCTTAAAGAGTCCAAAAGCCCAGATTCAAAAA
GGTTGCTATCATCCTTTCCGGTTGTGGTGTTTATGATGGTAGAATACTTTATTTCTTTTA
GGTTTAACGATATTTTGACAAGAGAAAAGTATATCAAATAATAAATAAATAAACAAACAG
AATGCAGAAATACTATTTTTTATAAAAAATGAATGTAAAAGCTAACATCTAAGTATATTT
CAATTTTATATAGGTTCTGAAGTTACTGAAGTTGTTTCTTTGATGGTTCACTTGAATAAG
AGTCATGTTTCCTTCTAATGTTTCGCTCCTAACTAAGACCAATTGCACGTTGTTAATCAC
ATTACTGGTGAAACTACCACTGAAACTAGAAACGTTTTAGTTGAATCTGCTAGAATTGCT
AGAGGAGAGGTCAAGGATATCACTTAACTTAAGGGTGAAGACTATCAAGCTGTCCTCCTT
CCCGGTGGTTTCGGTGCTGCTAAGAATCTTTCTGATTACGCTGTTAATGGTACTAACTTC
ACAGTTAACTCTGAAGTCGAAAGAGTCCTTAGGGTAATTTTACATATAAATTCTCTTTAT
ATTAGCCTAAAGTTATGGCTATTAAAAATATATAATATAAGCTCATTCATAATATCTAAG
GATTTAAATTAGATAATAAAAGCATTGACATAAAATTCTAAATTACATTTGTTAAAAAAT
AGGAATTCCACAGCCAAAAGAAGCCTATTGGTGCTATGTGCATTAGTCCTTTAATTTTAG
CTAAGGTTTTACAAAACGAAAAACCTAAAATCACCATGGGTAGAGTTGATAACCAAGACA
CCCCTAATAAATACTGGCCTCATAGTGAAGCTATCAATGCTGCTGAAACATTAGGTGCTC
AACATTTCCAAAGAAATGCCGATAGATTCTAAGTCGATTTCGAAAATAAAATAGTCACTG
CTCCTGCTATGATGTTTAACGGTTTCACCAAATTTTCTACTACTTTCGATGGAGCTGGTC
ACTTAGTTAACATTATTGATCAAATCGTCTAAGGTAACTCCATTAAGCTTGATACAATTG
GTGAAAAGAAGCATGAAAATTTCGATGGTGAAAGAAGACCTAGAGGTTAATATAATAGAA
ACAACAACAACAGAAGACCTAGAGAAAACAACAACGAAAATCACGAATAACACCATCATC
ACGAATAATAATGA