Identifiers and Description

Gene Model Identifier

TTHERM_01193550

Standard Name

LAP1 (Lysosomal Acid Phosphatase )

Aliases

PreTt18037 | 269.m00022

Description

Lysosomal acid phosphatase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00328 ) Histidine acid phosphatase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01193550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20723.19.997093137033517e-262protein kinase domain-containi
ng protein (1135 aa)
WormBaseWBGene000040231.0002869940498747e-21locus:pho-4 status:Confirmed
UniProt:Q22525 protein_id
:CCD68012.1
OxytrichaContig18062.0.g1101.9991095569230066e-20Histidine phosphatase superfam
ily (branch 2)
Stentor CoeruleusSteCoe_167671.5628821893349888e-18
DictyBaseDDB_G02847530.000000007998594485613997DDB_G0284753 on chromosome: 4
position 2432933 to 2434591

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01193550(coding)
ATGTCTAACTTGTTAAAGACTATTGTTATCTTACTTGCAATAACCACTGCAGTTTATTGT
ACAGTAGATGAATATGATCGCATGAAAAAAAGTACTCTTAAGCTTGTTGTTTAAATCTAC
AGACATGGTGCTAGATATCCTATTTATGATAAGACTTATGATGCAGCGGAATAAAAGAAA
ATGAATGGTGAACTCACTCCTGTTGGTATACGTTAACAATTTGAACTTGGTAGAAAGTTA
AGAGCCGAATATATTACTTCTTCTAGAGCATTTTTATCAACTAGCTACAATCCTCAAGAG
TTGTATGTTAGATCAACAGATGTTACTAGAACACTTATGTCTGCTGAAAGTCAATTAGCT
GGTTTATATCCATACGGCACTGGTCCTAAAATCCCTACTTAAGTTTAAGGATATTCTGCA
GATTAAAAAAAGCAAATTTTAGATGCACCTTACAAATTCTTTGACTAAAGTATTAGTTAG
GATATGACTGATGATGCTAATGCAATTCCTAATGGCTATTAACCTATTCCCATTCATACA
ATTAGTTAAAATTAAGATAAACTTCTTTTGGGTATGAGTTATGGTTGTCCTAACTCTTAA
AAGTGGACTGCTTAAAACAAATAGAGTGATGAATGGAAAAGAATTAACAAAGAGTTAAGT
GACACTATCTCTAAGTTTGCTAAAATTATGATAAAAGATGAAACTTAGCTTGCCTCTTTT
GACTTAACAAGCTTACAATAAAATATGGATACTCTCATTAGTGATTATTTCTAAGGAAGA
GATATTCCTACTGAGATGAAGGATAAAGATTTCTGGGAAAAAATTGAATAGTTACTCTAC
TTAGAAATCCATTTAGAATTATTAAAGACAAAGCAATAAAAGCAAGTATCTATTACACCA
TTCTTCAATTCTTTGATTGGTTACTTTGAAAAGAAGTTGAACAACACAGCTCCTTACAAG
TGGTACATGCACTCTGCTCACGACACCACTACTTCTATGATATTAGTTGGTATGAATTTA
ACTAGTTGGGAGTGTATGGAACGTTATCACACTAACTAATTATAAAAAGATGAAGTCTGT
ATCTACCAACCTACTACATATGCCACTAATCTTATGTACGAGCTTAGAGAAGATCCTGAT
ACCCATCAAAATTTTGTCATGTTTTCCATGAATGGATAGTACTTGCCCATATGTGATTAA
ACATCTAAATACTGTGACTACGAAGAATTTAAGAGAAGAATTGCTTAATAAGTTGTACCT
GATTTTGATCAGTAATGTGGATTTATTGAGGCTAAAGCTGCAGAAGTTTAATAATACACC
TTCTCTTCTAGTTTAACTTTTATAAGCATTAGTTTACTTCTTTTATCTTTACTTTGA


>TTHERM_01193550(protein)
MSNLLKTIVILLAITTAVYCTVDEYDRMKKSTLKLVVQIYRHGARYPIYDKTYDAAEQKK
MNGELTPVGIRQQFELGRKLRAEYITSSRAFLSTSYNPQELYVRSTDVTRTLMSAESQLA
GLYPYGTGPKIPTQVQGYSADQKKQILDAPYKFFDQSISQDMTDDANAIPNGYQPIPIHT
ISQNQDKLLLGMSYGCPNSQKWTAQNKQSDEWKRINKELSDTISKFAKIMIKDETQLASF
DLTSLQQNMDTLISDYFQGRDIPTEMKDKDFWEKIEQLLYLEIHLELLKTKQQKQVSITP
FFNSLIGYFEKKLNNTAPYKWYMHSAHDTTTSMILVGMNLTSWECMERYHTNQLQKDEVC
IYQPTTYATNLMYELREDPDTHQNFVMFSMNGQYLPICDQTSKYCDYEEFKRRIAQQVVP
DFDQQCGFIEAKAAEVQQYTFSSSLTFISISLLLLSLL


>TTHERM_01193550(gene)
AATAAATTAATTAAATTATTTTAGAGTTTAGCAATTTATTAAAATATGTCTAACTTGTTA
AAGACTATTGTTATCTTACTTGCAATAACCACTGCAGTTTATTGTACAGTAGATGAATAT
GATCGCATGAAAAAAAGTACTCTTAAGCTTGTTGTTTAAATCTACAGACATGGTGCTAGA
TATCCTATTTATGATAAGACTTATGATGCAGCGGAATAAAAGAAAATGAATGGTGAACTC
ACTCCTGTTGGTATACGTTAACAATTTGAACTTGGTAGAAAGTTAAGAGCCGAATATATT
ACTTCTTCTAGAGCATTTTTATCAACTAGCTACAATCCTCAAGAGTTGTATGTTAGATCA
ACAGATGTTACTAGGTATTTATTTATTTACTAAATTTTAATTAATTTATAAAATTCATTT
TATTTAAAATAATTTTTAAAAAGAACACTTATGTCTGCTGAAAGTCAATTAGCTGGTTTA
TATCCATACGGCACTGGTCCTAAAATCCCTACTTAAGTTTAAGGATATTCTGCAGATTAA
AAAAAGCAAATTTTAGATGCACCTTACAAATTCTTTGACTAAAGTATTAGTTAGGATATG
ACTGATGATGCTAATGCAATTCCTAATGGCTATTAACCTATTCCCATTCATACAATTAGT
TAAAATTAAGATAAACTTCTTTTGGGTATGAGTTATGGTTGTCCTAACTCTTAAAAGTGG
ACTGCTTAAAACAAATAGAGTGATGAATGGAAAAGAATTAACAAAGAGTTAAGTGACACT
ATCTCTAAGTTTGCTAAAATTATGATAAAAGATGAAACTTAGCTTGCCTCTTTTGACTTA
ACAAGCTTACAATAAAATATGGATACTCTCATTAGTGATTATTTCTAAGGAAGAGATATT
CCTACTGAGATGAAGGATAAAGATTTCTGGGAAAAAATTGAATAGTTACTCTACTTAGAA
ATCCATTTAGAATTATTAAAGACAAAGCAATAAAAGCAAGTATCTATTACACCATTCTTC
AATTCTTTGATTGGTTACTTTGAAAAGAAGTTGAACAACACAGCTCCTTACAAGTGGTAC
ATGCACTCTGCTCACGACACCACTACTTCTATGATATTAGTTGGTATGAATTTAACTAGT
TGGGAGTGTATGGAACGTTATCACACTAACTAATTATAAAAAGATGAAGTCTGTATCTAC
CAACCTACTACATATGCCACTAATCTTATGTACGAGCTTAGAGAAGATCCTGATACCCAT
CAAAATTTTGTCATGTTTTCCATGAATGGATAGTACTTGCCCATATGTGATTAAACATCT
AAATACTGTGACTACGAAGAATTTAAGAGAAGAATTGCTTAATAAGTTGTACCTGATTTT
GATCAGTAATGTGGATTTATTGAGGCTAAAGCTGCAGAAGTTTAATAATACACCTTCTCT
TCTAGTTTAACTTTTATAAGCATTAGTTTACTTCTTTTATCTTTACTTTGA