Identifiers and Description

Gene Model Identifier

TTHERM_00309880

Standard Name

KUL80 (KU80 like protein)

Aliases

PreTt21293 | 29.m00254 | 3696.m00073

Description

Ku70/Ku80 beta-barrel domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

  • ( PF08812 ) YtxC-like family
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00229 ) PAS domain S-box
  • ( TIGR01257 ) rim ABC transporter
  • ( PF02735 ) Ku70/Ku80 beta-barrel domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR01602 ) Plasmodium yoelii repeat of length
  • ( TIGR01637 ) phage transcriptional regulator, ArpU family
  • ( TIGR00578 ) ATP-dependent DNA helicase ii, 70

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00309880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_15200
Tetrahymena borealisEI9_11661.19.997093137033517e-262Ku70/Ku80 beta-barrel domain-c
ontaining protein (3177 aa)
OxytrichaContig289.1.g650.000000004999139696582238PAS domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00309880(coding)
ATGATAAAAATTATTAATTAAGATTAAATGAAAAATCAGAAAATAGCTTTTTGTTAGATT
AACTATTTAAATGTTTTTTAAATAATTTGTTATAAATATTTGAATATCACATTTACATAC
AACAAATTAATTTAGAAAAATAAAAAAAATGGATTAAATGGATTCATTCTTATTTTTTAT
AATAATTGGAAAACTTTTTTTACTCATTCATTCAATTGTAATGAATAATACTATAATTAA
TTTGAAGAAAAAGAAAAATTTAATTTATTAAATTAACAAATAAATAATTTCCAAAACAAA
AATTAACAGCATTAATTTAGAAATTATTAAATAGTTTATTAGAAAGGTAGGTACGTAGGT
AGAATCAATAATACATTAGACAAAAAAATGAAACAAAATTAGAAGCTATAAAAATTAAAT
ATCTACTTAATAGACAATAGACTTTTAAGGTTATTGTATAATTTTTATATTGAAAAGCTA
CATGACCTTTAGTCATCCTACTAGCGATCTTACAAGCTTTGCATTTTACTCAACTTAATA
AAAGCATGCTATATACTAATGATGCTTTTTAATAATTCTTCACTATAAGACATTAATAGC
TCTGGATCAGGATTCGAATTTTATACTTTCCTTGATGCAGAAGCTTATTTAGATAGAATT
TAAGGCAGTTTAATTTACTTATAAGTAACAGTTCTAAGTATAAATTCTGTTCTGATGATT
TATATATTCATTAAATTCTTATAGTTTGCAGCAAATTCTATTAATAATATGAAGCTTAGT
CATCTAGAAGGGGCAAATATAAATACAGGAGAGATATAGGTGAAATAAGATATTTACCAT
GAGATTATTTTCTCTTTTATTTTTCAAACATATGAATATATTATTATTATTCCTGCAATT
TATATATCGTGCATTCTAAGAAATGCTATATCTATCCCTGCTTTGGTATTAGCTATTCTA
AATGGATTAATAATTAAGGATTCAGATTATAATTACTTAATTTCAAGTAAAGATTTCCTT
TCTAAAAGGTATATATGGTCTGATAAGATACTATATCTATTATAGTGTCTCTTGTTATCA
ATTTATGCTTTAGAAAAAGGAATTTTTGGTTTATGGATGATAATACTATATGTATTTTTA
GAGCTTGCTTTTATAATATATAAAAGACCATACTTCTCAAAGCATATGGAAGGAATAATT
ATGTGGATTAAAATTTTTATCTTAATGCTTTATATTTCGTGCATCAGCTTAAGATCAAAT
ATTGACTAAGGTCCCAGCTTATTTTTTGTTTTACTAGCTCTATCAGTTCCTATTTCACTT
AAAATTACAAGGATAATAATTAATTAATAGTTAACTATGATAGAAAATGAATTAGAGAGG
TTAATGAATAGTACTACTTTATCATAAGAAGATAATAATAGTAAACATATTGATTAAATA
ATTAGAATGATCATATATCCAGAGAGAGTTTTTCTTAGTAATCAATAAAATTTCCTATTT
AATTTAATTATCCCTCATGTTCATAAGAGTGATGCATAAATCAAAAGAGATATTTTCAAA
GCAAATTTACTTCGCACATTTTAAGTAAAATTATTTAGAGAAATAGACTATGAACTGAAT
GAGTTAAAAAAACTATAAGCTGGATAAAATATTGGTGAGAGAGGTAAGACAAAAAAGCTT
GGGAGATCTTAAAATTAATCTGGTAATGAAAGTAATTACGATCAAGATGAAATGGCATAA
AACTAGCTGGATGCTTATAATGAAGCAAAGCAAGAAATTCTTGCATAACAATATGCATTA
AATGAAAAATAGATACATGGTAAAATTTATATTGAAAAAGCATAGGTGTATGGAGATGAT
AAAGTCATGGAGGAGAATCTGTAATCGTATTTTCATAGAGTAATTCAAAATACTAAAGAT
AAACAAGAATTTACAGAGATTGATGTTATACATCTTGTATATATTTTAGAAATTTTAAAT
AATGAAAAACTATTTGAATTAAAATTCTTTCAGAATAAGAAAAAAATGTCAATCAAGCAT
TAACAAATAGTCAAATCTTTGTTTTCCGAGTCATACGAAAAGAAAAATATGCATATAAAA
GAGTATGGAAAAGAGAGTATATTCCATACTGAGCTTTAAGAAGCCTTGAGCTATGACAGT
CTTATCAACTTATTGCAGTTTTGGATAGACGAAACGATAGAAAAGAAACTTCTTATCCTA
AGTGTTATGCGATAGAGACACATTATACTTGACGAGCTTAGAAAAATGCTAGAAGATGTT
CAATTTAGGCGCAGCTAAATTATCAAAACAATATCCCATTTAGTATAACTAAATGATAAA
AATAGCAAACTTCATTCTCTTTACATTTGTTATTTAGAAAATCTTTCTTTTACAGATAAA
GACATCAACCTAAACAAATTTAAAAAGCAGTAATAAATAAACTCAGTCTAAAGAAACTAT
TTAGCTAAGCTTGATAAAAGTGATTCATGTGTTGTTTTTGCTAGTGTAGGCAAGTCAAAT
AAAGGATTTTTAATAAAGAAAATTACATAAACTTTTGAAAGAATTTTTAATTACAAACCT
GTTGAGATTATAAATGCTTCTATAGAGAAGTTAATGCCTTATCCTTACTAAAAGCCTCAT
GCTAAACTGATCAAGGATTTCTTCAGCGATAATATGTAAAATGAAAAAGGAAATGTCCCT
CTTGCTTTTGGTTTAAGTCAAAAAGGATATATTATACCTTTAGAGATAAGCATTAGAATA
AATAATTTTCAAGGTGATTTTGGACTGTCAGCATATCTATAAGTTTTAGATAAAAACTAA
TTAGTCAATGAATATCAACAATAGTATTATAATTATTTATCTAAAGAATACCTAATATAC
GATGAAAGCAATTTAAAAGTAATATCCATGACATTTGCCCTTCATAGTCTACTCTTTTAC
AGATTTAAAAGTATTCATTCTATTTACTTAAGAGGCTTTTTCCCCTTTCTCAGAAAAATT
TTCTAAAACCACTCGATGAGGTCATCTAACACAGGAAGAAGCAAGAGCGCTAAATCCTCA
AATAGCTTGCTTTAATCAAGTAGGTACTTAAACTCTAACCGCAGTATTACAAGTTAAAGA
AGAAGAGCATAAAATATGATGAAAGAATTAGATAAAAAAAAAAAAGATGTAAATGGATCT
TAAGCATCTATAAGCAGTGATAAAAAGCACAAATAAAAAAAAATTTAGAAAGAAAAAGAA
AGATTAAGCAGCTTATACTCAAGAACTTTAACTAAAAATGTAGAAGAAATGGATTTTTTA
ATGATTGTTCAAAAAGGTGAATCTATTTCTGATGATGACAGTCCTTAATACATTGAAAGT
AATTTTTAATTCTTTACTATGTATGTTCAAATTTGTGAAGACAGGATAGGATAAAACAAT
CAGCCTATTCGTTACTTAGAAATAACTAAAATATAAGAAGTAAATGCCTTTAATAACTCA
GGCTTTTTGCTGAATGTGTTTGATGATTAAATAAATATGCTAACAAATAAATAATTTTTT
ACGTAATAAGTTTAAAATAAAATTATTTAACATTTAGAAAAATTTTACTTTTTCTAATAA
CTGATTTAAAATGGTGAAATTAACATTTCGGACTTAAAAGTTAATGAAAATAAATTAAGT
TTAAAAAATTTATAAAGAAGTAGTTATATGAGTCCAAAAAAAGGCAAATACTCAAATAAT
GAAATATATAAATACTATATATCTTATGGATATAGCCAACTTCCTGAAGTAATTAATGAA
TTTGAGTATGAAAAAGAAGAATCTACATTAGACAATAAAAGGTTTACTTTTTCCAATTAG
CAAGAGTAAAAAGCTGAATAAGCTAAATTGCATGACAACCCAGATAATATTAATTATGAA
TAGTTAGATAAATTTTTCAACAATAGAGAACCAGAAAAAGCACATAGAGGAAATGTCAAC
AGCCAATCAAAAGAAAAGTAGCCTAGATTAAGCTAACTTGCAAACATAGCTAAGTATAAA
TTCAATACCTAAGAATATGTCAAAAAGCCAAATTATAAAAGTGAACTTAATGAAGATTAG
AAATAAAATCACATTTCAATTTTTCAAGGTAGACAAGTTAAGTTAGCGAAGCAGTAATCA
GAAGATTTGAGTTTTGTGAGTAGTTAGATAGATTTGTAAGAAAGTCCTCGAAAAAAGTAA
GATGGTCAAATTAAACTAAAAAATTTAGATTAAGCTTAAACATCACAAAAACAGTCAGAA
AATTAAGTGAAAAAGATAGAAGCCACTGAAACTATTTCTCCAGTGAAAAATTAAATCAAT
TTTCCTTATTCTCCTTCTCAGTCATTAAGTTTTCATTAAGCGAGTAACCAAAAAGGATAA
GAGCTTCTAAGTCCAAGCTAGCAAAACGTTATTCCATAATTTAATATGGATGATATAAAT
TTTCAAAATACACCTTTGAACTCCAAAGTACAGCATGCTGTATTTGGTGAGGCTGCAAAT
CAAAATCATAACATATACTAAAACAATCAATATTATTCATTAAATTATGATAATTCTATG
CAGTATCTAGCAGGTGATAATAGTAAATAAAATAATATTGATTCCTAAGTAATGAGCCCT
CAAGCAGCTGTAGCTACAACTTTTTATTAAGATAATTAGCTGAATAATTATCTTTCTCAA
AGCTAAATACTAACTCCTAGTAACAGCTAAGGAATTATTCCATAACAATATGGGCTATTA
GGACCTTAATTAGATTAAAATATATTTTAAAATCCAAGTTAAAGTAGCTTAATGAATATA
AGCAACTTAAATATAACAAATGTTAATAATAATTTTATATATGACAATAAATAAATTTAA
AACTAAAAGAGCTCGAAATTTTTTAGTTCTAAATTAAACTAAATGTCACAGTTGAAAAGT
CTACGCAGTAAAGTCAGTTCAAATACACAGCCTAATTTCATTTAACAGTTTTCTACCTTA
AATCCTGGAAGTAATGACCCTTCTAAAGAATTTTCAGGATAATCATAAAGCAAGGATATT
GAAGATACGAAAACAAAAAAAAAATAATACATAAATATCTAAGATGCAGTTGAATCTTCT
TCTACTCACTCAAAATTGTCTAACATATCTTCTTAAAAAAAGCAAGTTAATCACATAATT
TTTAGCACAAAAGATCTAAATGCAATGAAAATCATTAATATTTTTGGTTTCCTGAGTATA
TCAGTAATTATATTTGTTACACTCTTTTAGTATTATCAAATAATAACTACATTTTAAGAC
TTTGAATCAGATTGTAATATATCTGATGTGCCTACAAGGTATGTTTCTAATATGGCATAT
ATAGTTTATGGAAAGAGTTTTCAATTTCTGCTTTAAAACAATTTCTTCACCTTAACTGAT
ATTTAAGTTTAACAAGAATTATCTAATATAAAGTAAGTGTATAATAACACATTCACTTAA
TAGCTGTCTATGCTAATTTCTTTAAGTATCCCATAGCCAACAAACCAATTAGTATTTTAT
CTGATCGATGGCTAATATATTGCTAATTTATCTTCTCTTTATGGAACGGATAGCAGTCTT
GTTGGAGTTAACAGCAATGATTTAAATAATTACAAAACATATAATTATGCTACTAATGTA
TTTTATGGTTGCATTTTAACCTTCTAATACTTTTTTCGCTTTGTTTATGGGTCAGGTAAT
CCAAGATCTACTTATATTGCATTATCAAATCAAGACAGATTGTAAGTAGAGCTACTAAAT
TTATTTAATTAATCAGAACAGGATCAGCTAGATTCAATAACTGTAAATCGTGATTTAGTT
ACAAAGCTAATGGTTTTGATTTTAATTATATGTCCTTTATGTGTATCAATTGTCTTACCT
CTTTATGCATACATATAAACCAAAAGACAGGAGATTTTAATGCTGTTTGGAACATTCAGT
ATATAGCGTCTAGATTAGTGCATGCAAGATACCAAATTCACCACTTTCTACTTATTTGAT
ATTAGCTCTAATTAGGCCGCAAGTTAAAAATAAAATGTTTAAAGGTAGTTGCTAAATAGT
AAAGAGACATAAAAAAAATAAACACTAAGTTCATCAACTCCCTTACCAAAAATATCATTA
GTCCTTGTTTTCTTAAGTATAGTAATAATTCTCTTCACATTACCTTATCCTATAGCAAAT
TAATAAATATCTTTCAGATTTATAGATTAAGACAGTTTAACACTTTAGCTTAAGCTCGAA
TTATCATAGCTTCGTATGAATATTCTAGAATCAGTAAGCAGTGCCTATTACTCTTTCTAT
TTAAAGATTCATCCAGAATTATAGAAATAATATAATATAACCTATTATATGACAAAACTT
TAAAACTCAACCTCAAATATTGGATAAACGCAGCTACAAATTTAATCTTTATTTAATTAA
ATCTCCTTATAAAACATGTTTTAGCAAGATTTTTATAATAATTTCATTCCTAGCTACTTT
GAAAAAAGCTTATGTGGCAGTTATGTTTAATCTTCATATGTTGTATAACTTACTGATTTA
AATCAATAAATATGTGACTAGCTTCATAATGGAATTTTGAATTAAGGAGCTTTCTTTATT
TTAAAAACAACTATCTAAATATTAAATGATTACTATGAAATGGCTTAGATATAATCTATA
TCAGATTTTTAGAATGCATATTAATAATATGAATAATCTTTTTCAACTATGGACTTTAAT
TAAATGTTTAATATATTAGCTGATACATTAGATGCTATGACAGATGGTATTGACAAATAA
ATGACTAGTTATTTTGATTATATAAAAGTAATATCTATTATTTTGATGGTCTATCAATTT
TTGGTTGTTGGAGTAATTTTGATTATAAGTTGGATTTTCTTCTATATTTCTCTTGGAAGG
TAGCTCAATGAAACCAAACAGCTTTTATCTGTAATAGACATTTATTCTATAGTTAACAAT
CCCTATATACATAACTTCTTAATATAAAATTTAAGGAGCTGA


>TTHERM_00309880(protein)
MIKIINQDQMKNQKIAFCQINYLNVFQIICYKYLNITFTYNKLIQKNKKNGLNGFILIFY
NNWKTFFTHSFNCNEQYYNQFEEKEKFNLLNQQINNFQNKNQQHQFRNYQIVYQKGRYVG
RINNTLDKKMKQNQKLQKLNIYLIDNRLLRLLYNFYIEKLHDLQSSYQRSYKLCILLNLI
KACYILMMLFNNSSLQDINSSGSGFEFYTFLDAEAYLDRIQGSLIYLQVTVLSINSVLMI
YIFIKFLQFAANSINNMKLSHLEGANINTGEIQVKQDIYHEIIFSFIFQTYEYIIIIPAI
YISCILRNAISIPALVLAILNGLIIKDSDYNYLISSKDFLSKRYIWSDKILYLLQCLLLS
IYALEKGIFGLWMIILYVFLELAFIIYKRPYFSKHMEGIIMWIKIFILMLYISCISLRSN
IDQGPSLFFVLLALSVPISLKITRIIINQQLTMIENELERLMNSTTLSQEDNNSKHIDQI
IRMIIYPERVFLSNQQNFLFNLIIPHVHKSDAQIKRDIFKANLLRTFQVKLFREIDYELN
ELKKLQAGQNIGERGKTKKLGRSQNQSGNESNYDQDEMAQNQLDAYNEAKQEILAQQYAL
NEKQIHGKIYIEKAQVYGDDKVMEENLQSYFHRVIQNTKDKQEFTEIDVIHLVYILEILN
NEKLFELKFFQNKKKMSIKHQQIVKSLFSESYEKKNMHIKEYGKESIFHTELQEALSYDS
LINLLQFWIDETIEKKLLILSVMRQRHIILDELRKMLEDVQFRRSQIIKTISHLVQLNDK
NSKLHSLYICYLENLSFTDKDINLNKFKKQQQINSVQRNYLAKLDKSDSCVVFASVGKSN
KGFLIKKITQTFERIFNYKPVEIINASIEKLMPYPYQKPHAKLIKDFFSDNMQNEKGNVP
LAFGLSQKGYIIPLEISIRINNFQGDFGLSAYLQVLDKNQLVNEYQQQYYNYLSKEYLIY
DESNLKVISMTFALHSLLFYRFKSIHSIYLRGFFPFLRKIFQNHSMRSSNTGRSKSAKSS
NSLLQSSRYLNSNRSITSQRRRAQNMMKELDKKKKDVNGSQASISSDKKHKQKKIQKEKE
RLSSLYSRTLTKNVEEMDFLMIVQKGESISDDDSPQYIESNFQFFTMYVQICEDRIGQNN
QPIRYLEITKIQEVNAFNNSGFLLNVFDDQINMLTNKQFFTQQVQNKIIQHLEKFYFFQQ
LIQNGEINISDLKVNENKLSLKNLQRSSYMSPKKGKYSNNEIYKYYISYGYSQLPEVINE
FEYEKEESTLDNKRFTFSNQQEQKAEQAKLHDNPDNINYEQLDKFFNNREPEKAHRGNVN
SQSKEKQPRLSQLANIAKYKFNTQEYVKKPNYKSELNEDQKQNHISIFQGRQVKLAKQQS
EDLSFVSSQIDLQESPRKKQDGQIKLKNLDQAQTSQKQSENQVKKIEATETISPVKNQIN
FPYSPSQSLSFHQASNQKGQELLSPSQQNVIPQFNMDDINFQNTPLNSKVQHAVFGEAAN
QNHNIYQNNQYYSLNYDNSMQYLAGDNSKQNNIDSQVMSPQAAVATTFYQDNQLNNYLSQ
SQILTPSNSQGIIPQQYGLLGPQLDQNIFQNPSQSSLMNISNLNITNVNNNFIYDNKQIQ
NQKSSKFFSSKLNQMSQLKSLRSKVSSNTQPNFIQQFSTLNPGSNDPSKEFSGQSQSKDI
EDTKTKKKQYINIQDAVESSSTHSKLSNISSQKKQVNHIIFSTKDLNAMKIINIFGFLSI
SVIIFVTLFQYYQIITTFQDFESDCNISDVPTRYVSNMAYIVYGKSFQFLLQNNFFTLTD
IQVQQELSNIKQVYNNTFTQQLSMLISLSIPQPTNQLVFYLIDGQYIANLSSLYGTDSSL
VGVNSNDLNNYKTYNYATNVFYGCILTFQYFFRFVYGSGNPRSTYIALSNQDRLQVELLN
LFNQSEQDQLDSITVNRDLVTKLMVLILIICPLCVSIVLPLYAYIQTKRQEILMLFGTFS
IQRLDQCMQDTKFTTFYLFDISSNQAASQKQNVQRQLLNSKETQKKQTLSSSTPLPKISL
VLVFLSIVIILFTLPYPIANQQISFRFIDQDSLTLQLKLELSQLRMNILESVSSAYYSFY
LKIHPELQKQYNITYYMTKLQNSTSNIGQTQLQIQSLFNQISLQNMFQQDFYNNFIPSYF
EKSLCGSYVQSSYVVQLTDLNQQICDQLHNGILNQGAFFILKTTIQILNDYYEMAQIQSI
SDFQNAYQQYEQSFSTMDFNQMFNILADTLDAMTDGIDKQMTSYFDYIKVISIILMVYQF
LVVGVILIISWIFFYISLGRQLNETKQLLSVIDIYSIVNNPYIHNFLIQNLRS


>TTHERM_00309880(gene)
ATGATAAAAATTATTAATTAAGATTAAATGAAAAATCAGAAAATAGCTTTTTGTTAGATT
AACTATTTAAATGTTTTTTAAATAATTTGTTATAAATATTTGAATATCACATTTACATAC
AACAAATTAATTTAGAAAAATAAAAAAAATGGATTAAATGGATTCATTCTTATTTTTTAT
AATAATTGGAAAACTTTTTTTACTCATTCATTCAATTGTAATGAATAATACTATAATTAA
TTTGAAGAAAAAGAAAAATTTAATTTATTAAATTAACAAATAAATAATTTCCAAAACAAA
AATTAACAGCATTAATTTAGAAATTATTAAATAGTTTATTAGAAAGGTAGGTACGTAGGT
AGAATCAATAATACATTAGACAAAAAAATGAAACAAAATTAGAAGCTATAAAAATTAAAT
ATCTACTTAATAGACAATAGACTTTTAAGGTTATTGTATAATTTTTATATTGAAAAGCTA
CATGACCTTTAGTCATCCTACTAGCGATCTTACAAGCTTTGCATTTTACTCAACTTAATA
AAAGCATGCTATATACTAATGATGCTTTTTAATAATTCTTCACTATAAGACATTAATAGC
TCTGGATCAGGATTCGAATTTTATACTTTCCTTGATGCAGAAGCTTATTTAGATAGAATT
TAAGGCAGTTTAATTTACTTATAAGTAACAGTTCTAAGTATAAATTCTGTTCTGATGATT
TATATATTCATTAAATTCTTATAGTTTGCAGCAAATTCTATTAATAATATGAAGCTTAGT
CATCTAGAAGGGGCAAATATAAATACAGGAGAGATATAGGTGAAATAAGATATTTACCAT
GAGATTATTTTCTCTTTTATTTTTCAAACATATGAATATATTATTATTATTCCTGCAATT
TATATATCGTGCATTCTAAGAAATGCTATATCTATCCCTGCTTTGGTATTAGCTATTCTA
AATGGTAAATTATTAGAAAAATTATTTTATACTTTTATATCATCTGCAATTATTTGTTTT
TAATTTTATGAAATACATATTATATATGAATTATAAAAAGGATTAATAATTAAGGATTCA
GATTATAATTACTTAATTTCAAGTAAAGATTTCCTTTCTAAAAGGTATATATGGTCTGAT
AAGATACTATATCTATTATAGTGTCTCTTGTTATCAATTTATGCTTTAGAAAAAGGAATT
TTTGGTTTATGGATGATAATACTATATGTATTTTTAGAGCTTGCTTTTATAATATATAAA
AGACCATACTTCTCAAAGCATATGGAAGGAATAATTATGTGGATTAAAATTTTTATCTTA
ATGCTTTATATTTCGTGCATCAGCTTAAGATCAAATATTGACTAAGGTCCCAGCTTATTT
TTTGTTTTACTAGCTCTATCAGTTCCTATTTCACTTAAAATTACAAGGATAATAATTAAT
TAATAGTTAACTATGATAGAAAATGAATTAGAGAGGTTAATGAATAGTACTACTTTATCA
TAAGAAGATAATAATAGTAAACATATTGATTAAATAATTAGAATGATCATATATCCAGAG
AGAGTTTTTCTTAGTAATCAATAAAATTTCCTATTTAATTTAATTATCCCTCATGTTCAT
AAGAGTGATGCATAAATCAAAAGAGATATTTTCAAAGCAAATTTACTTCGCACATTTTAA
GTAAAATTATTTAGAGAAATAGACTATGAACTGAATGAGTTAAAAAAACTATAAGCTGGA
TAAAATATTGGTGAGAGAGGTAAGACAAAAAAGCTTGGGAGATCTTAAAATTAATCTGGT
AATGAAAGTAATTACGATCAAGATGAAATGGCATAAAACTAGCTGGATGCTTATAATGAA
GCAAAGCAAGAAATTCTTGCATAACAATATGCATTAAATGAAAAATAGATACATGGTAAA
ATTTATATTGAAAAAGCATAGGTGTATGGAGATGATAAAGTCATGGAGGAGAATCTGTAA
TCGTATTTTCATAGAGTAATTCAAAATACTAAAGATAAACAAGAATTTACAGAGATTGAT
GTTATACATCTTGTATATATTTTAGAAATTTTAAATAATGAAAAACTATTTGAATTAAAA
TTCTTTCAGAATAAGAAAAAAATGTCAATCAAGCATTAACAAATAGTCAAATCTTTGTTT
TCCGAGTCATACGAAAAGAAAAATATGCATATAAAAGAGTATGGAAAAGAGAGTATATTC
CATACTGAGCTTTAAGAAGCCTTGAGCTATGACAGTCTTATCAACTTATTGCAGTTTTGG
ATAGACGAAACGATAGAAAAGAAACTTCTTATCCTAAGTGTTATGCGATAGAGACACATT
ATACTTGACGAGCTTAGAAAAATGCTAGAAGATGTTCAATTTAGGCGCAGCTAAATTATC
AAAACAATATCCCATTTAGTATAACTAAATGATAAAAATAGCAAACTTCATTCTCTTTAC
ATTTGTTATTTAGAAAATCTTTCTTTTACAGATAAAGACATCAACCTAAACAAATTTAAA
AAGCAGTAATAAATAAACTCAGTCTAAAGAAACTATTTAGCTAAGCTTGATAAAAGTGAT
TCATGTGTTGTTTTTGCTAGTGTAGGCAAGTCAAATAAAGGATTTTTAATAAAGAAAATT
ACATAAACTTTTGAAAGAATTTTTAATTACAAACCTGTTGAGATTATAAATGCTTCTATA
GAGAAGTTAATGCCTTATCCTTACTAAAAGCCTCATGCTAAACTGATCAAGGATTTCTTC
AGCGATAATATGTAAAATGAAAAAGGAAATGTCCCTCTTGCTTTTGGTTTAAGTCAAAAA
GGATATATTATACCTTTAGAGATAAGCATTAGAATAAATAATTTTCAAGGTGATTTTGGA
CTGTCAGCATATCTATAAGTTTTAGATAAAAACTAATTAGTCAATGAATATCAACAATAG
TATTATAATTATTTATCTAAAGAATACCTAATATACGATGAAAGCAATTTAAAAGTAATA
TCCATGACATTTGCCCTTCATAGTCTACTCTTTTACAGATTTAAAAGTATTCATTCTATT
TACTTAAGAGGCTTTTTCCCCTTTCTCAGAAAAATTTTCTAAAACCACTCGATGAGGTCA
TCTAACACAGGAAGAAGCAAGAGCGCTAAATCCTCAAATAGCTTGCTTTAATCAAGTAGG
TACTTAAACTCTAACCGCAGTATTACAAGTTAAAGAAGAAGAGCATAAAATATGATGAAA
GAATTAGATAAAAAAAAAAAAGATGTAAATGGATCTTAAGCATCTATAAGCAGTGATAAA
AAGCACAAATAAAAAAAAATTTAGAAAGAAAAAGAAAGATTAAGCAGCTTATACTCAAGA
ACTTTAACTAAAAATGTAGAAGAAATGGATTTTTTAATGATTGTTCAAAAAGGTGAATCT
ATTTCTGATGATGACAGTCCTTAATACATTGAAAGTAATTTTTAATTCTTTACTATGTAT
GTTCAAATTTGTGAAGACAGGATAGGATAAAACAATCAGCCTATTCGTTACTTAGAAATA
ACTAAAATATAAGAAGTAAATGCCTTTAATAACTCAGGCTTTTTGCTGAATGTGTTTGAT
GATTAAATAAATATGCTAACAAATAAATAATTTTTTACGTAATAAGTTTAAAATAAAATT
ATTTAACATTTAGAAAAATTTTACTTTTTCTAATAACTGATTTAAAATGGTGAAATTAAC
ATTTCGGACTTAAAAGTTAATGAAAATAAATTAAGTTTAAAAAATTTATAAAGAAGTAGT
TATATGAGTCCAAAAAAAGGCAAATACTCAAATAATGAAATATATAAATACTATATATCT
TATGGATATAGCCAACTTCCTGAAGTAATTAATGAATTTGAGTATGAAAAAGAAGAATCT
ACATTAGACAATAAAAGGTTTACTTTTTCCAATTAGCAAGAGTAAAAAGCTGAATAAGCT
AAATTGCATGACAACCCAGATAATATTAATTATGAATAGTTAGATAAATTTTTCAACAAT
AGAGAACCAGAAAAAGCACATAGAGGAAATGTCAACAGCCAATCAAAAGAAAAGTAGCCT
AGATTAAGCTAACTTGCAAACATAGCTAAGTATAAATTCAATACCTAAGAATATGTCAAA
AAGCCAAATTATAAAAGTGAAGTAATCAATTTTTTTTCTAATTCCTCAATCTATATTTTA
TTGATTTTAAATTTTATGTTACTAAAACTTTATGTTTGAAATTAAATAATATAATAAGAA
AATAATTAAAATAACCTTGAAATATATTAAGAAATAAGAGGGTATAAAGAAAAATTTCAA
TTTTTTATTTACCAAAATATACTAATACAAAGCAATTTATTTTGTTCAATTAAAAAAAAA
AAATTTTTTTTATACCCACTGCATTAAATTAAAATATTTATTTTTTATTAAAAATATCTT
AATAGCTTAATGAAGATTAGAAATAAAATCACATTTCAATTTTTCAAGGTAGACAAGTTA
AGTTAGCGAAGCAGTAATCAGAAGATTTGAGTTTTGTGAGTAGTTAGATAGATTTGTAAG
AAAGTCCTCGAAAAAAGTAAGATGGTCAAATTAAACTAAAAAATTTAGATTAAGCTTAAA
CATCACAAAAACAGTCAGAAAATTAAGTGAAAAAGATAGAAGCCACTGAAACTATTTCTC
CAGTGAAAAATTAAATCAATTTTCCTTATTCTCCTTCTCAGTCATTAAGTTTTCATTAAG
CGAGTAACCAAAAAGGATAAGAGCTTCTAAGTCCAAGCTAGCAAAACGTTATTCCATAAT
TTAATATGGATGATATAAATTTTCAAAATACACCTTTGAACTCCAAAGTACAGCATGCTG
TATTTGGTGAGGCTGCAAATCAAAATCATAACATATACTAAAACAATCAATATTATTCAT
TAAATTATGATAATTCTATGCAGTATCTAGCAGGTGATAATAGTAAATAAAATAATATTG
ATTCCTAAGTAATGAGCCCTCAAGCAGCTGTAGCTACAACTTTTTATTAAGATAATTAGC
TGAATAATTATCTTTCTCAAAGCTAAATACTAACTCCTAGTAACAGCTAAGGAATTATTC
CATAACAATATGGGCTATTAGGACCTTAATTAGATTAAAATATATTTTAAAATCCAAGTT
AAAGTAGCTTAATGAATATAAGCAACTTAAATATAACAAATGTTAATAATAATTTTATAT
ATGACAATAAATAAATTTAAAACTAAAAGAGCTCGAAATTTTTTAGTTCTAAATTAAACT
AAATGTCACAGTTGAAAAGTCTACGCAGTAAAGTCAGTTCAAATACACAGCCTAATTTCA
TTTAACAGTTTTCTACCTTAAATCCTGGAAGTAATGACCCTTCTAAAGAATTTTCAGGAT
AATCATAAAGCAAGGATATTGAAGATACGAAAACAAAAAAAAAATAATACATAAATATCT
AAGATGCAGTTGAATCTTCTTCTACTCACTCAAAATTGTCTAACATATCTTCTTAAAAAA
AGCAAGTTAATCACATAATTTTTAGCACAAAAGATCTAAATGCAATGAAAATCATTAATA
TTTTTGGTTTCCTGAGTATATCAGTAATTATATTTGTTACACTCTTTTAGTATTATCAAA
TAATAACTACATTTTAAGACTTTGAATCAGATTGTAATATATCTGATGTGCCTACAAGGT
ATGTTTCTAATATGGCATATATAGTTTATGGAAAGAGTTTTCAATTTCTGCTTTAAAACA
ATTTCTTCACCTTAACTGATATTTAAGTTTAACAAGAATTATCTAATATAAAGTAAGTGT
ATAATAACACATTCACTTAATAGCTGTCTATGCTAATTTCTTTAAGTATCCCATAGCCAA
CAAACCAATTAGTATTTTATCTGATCGATGGCTAATATATTGCTAATTTATCTTCTCTTT
ATGGAACGGATAGCAGTCTTGTTGGAGTTAACAGCAATGATTTAAATAATTACAAAACAT
ATAATTATGCTACTAATGTATTTTATGGTTGCATTTTAACCTTCTAATACTTTTTTCGCT
TTGTTTATGGGTCAGGTAATCCAAGATCTACTTATATTGCATTATCAAATCAAGACAGAT
TGTAAGTAGAGCTACTAAATTTATTTAATTAATCAGAACAGGATCAGCTAGATTCAATAA
CTGTAAATCGTGATTTAGTTACAAAGCTAATGGTTTTGATTTTAATTATATGTCCTTTAT
GTGTATCAATTGTCTTACCTCTTTATGCATACATATAAACCAAAAGACAGGAGATTTTAA
TGCTGTTTGGAACATTCAGTATATAGCGTCTAGATTAGTGCATGCAAGATACCAAATTCA
CCACTTTCTACTTATTTGATATTAGCTCTAATTAGGCCGCAAGTTAAAAATAAAATGTTT
AAAGGTAGTTGCTAAATAGTAAAGAGACATAAAAAAAATAAACACTAAGTTCATCAACTC
CCTTACCAAAAATATCATTAGTCCTTGTTTTCTTAAGTATAGTAATAATTCTCTTCACAT
TACCTTATCCTATAGCAAATTAATAAATATCTTTCAGATTTATAGATTAAGACAGTTTAA
CACTTTAGCTTAAGCGTATATTTTATTAATTTTCAATTTTTGAATAATAAAATATCTTTT
TTAAAAAGTCGAATTATCATAGCTTCGTATGAATATTCTAGAATCAGTAAGCAGTGCCTA
TTACTCTTTCTATTTAAAGATTCATCCAGAATTATAGAAATAATATAATATAACCTATTA
TATGACAAAACTTTAAAACTCAACCTCAAATATTGGATAAACGCAGCTACAAATTTAATC
TTTATTTAATTAAATCTCCTTATAAAACATGTAAATTTGTTAATTATTATAAATTTTACT
CATTTACTATTAATTATTTTTCAACAATATGCTGAAAAATAAAATTTAACTACATTTAAA
AGCTTAACCAATAGATAGTGCCTAAGTGATAAAACAAATTTATGAATTTTGTTGTCACAT
GAATAAGGCATAATAAAATTTATGATATTTTATATACAGATTCAATTAAAATATTGAATT
TTTAGTAAAAATAATTTTTTTAAAGTGTTAACAAAAATTTCTCATTTTTTATAAATTTTA
ATGCTTAAAAATCTCCCTTAAATAAAAATTAAATTAATTAATTAATGTAATCCCTTAAAC
AATTTTAGGTTATCTGCAAATTATCTTTTACAAAAAATAATTTAAAACATTTAAAAAATT
TTGAAATTTTGATGAAATTATTTTAATTAATAAATGCAGTTTTTGTTGTGAATATAATTT
ATTTTAAAAATTATTTTATTTTAAAGTTAAATATTTTTAAATAATTAAGTGAAAACAAAC
TTTAATAAAAAATAGGTTTTAGCAAGATTTTTATAATAATTTCATTCCTAGCTACTTTGA
AAAAAGCTTATGTGGCAGTTATGTTTAATCTTCATATGTTGTATAACTTACTGATTTAAA
TCAATAAATATGTGACTAGCTTCATAATGGAATTTTGAATTAAGGAGCTTTCTTTATTTT
AAAAACAACTATCTAAATATTAAATGATTACTATGAAATGGCTTAGATATAATCTATATC
AGATTTTTAGAATGCATATTAATAATATGAATAATCTTTTTCAACTATGGACTTTAATTA
AATGTTTAATATATTAGCTGATACATTAGATGCTATGACAGATGGTATTGACAAATAAAT
GACTAGTTATTTTGATTATATAAAAGTAATATCTATTATTTTGATGGTCTATCAATTTTT
GGTTGTTGGAGTAATTTTGATTATAAGTTGGATTTTCTTCTATATTTCTCTTGGAAGGTA
GCTCAATGAAACCAAACAGCTTTTATCTGTAATAGACATTTATTCTATAGTTAACAATCC
CTATATACATAACTTCTTAATATAAAATTTAAGGAGCTGA