Identifiers and Description

Gene Model Identifier

TTHERM_01444910

Standard Name

KTI12 (Kluveromyces lactis Toxin Insensitive 12)

Aliases

PreTt30389 | 393.m00012

Description

Kluveromyces lactis toxin insensitive protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_01444910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20738.19.997093137033517e-262KTI12 protein (277 aa)
OxytrichaContig16260.0.g375.001369568193564e-73Chromatin associated protein K
TI12
DictyBaseDDB_G02756671.0001801308941382e-55DDB_G0275667 on chromosome: 2
position 5787522 to 5788532
WormBaseWBGene000133326.99868990988981e-32status:Confirmed UniProt:Q7Y
TI4 protein_id:CAE18026.1
SGDYKL110C9.99967697349061e-30KTI12 Protein that plays a rol
e, with Elongator complex, in
modification of wobble nucleos
ides in tRNA; involved in sens
itivity to G1 arrest induced b
y zymocin; interacts with chro
matin throughout the genome; a
lso interacts with Cdc19p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01444910(coding)
ATGCCTTTAATAGTATTTTGCGGAATTCCAGGCTCAGGAAAGACAACAAGAGCTTTATAA
ATCAAGGAATATTTAGAATAGAAACATAAATGTTAGGTTGTTCATTTGAATGAAGAGATA
CTTTAAATGGAAAAGAAAGAAGTTTACAAAGATTTTTAGGCAGAAAAATTCGCAAGAGGA
TTCTTAAGATCTAATGTTGAGAAAAATATAGCTGGAAATACAGTTGTGATTTTGGATTCA
CTAAATTATATAAAAGGTTATAGATATGAATTGTTTTGCCTTGCTAGAGCTGCTTAAACT
TAACATTGTGTTATTTATTGTGAATGTGATCCATAATTAGCAAAAGAAAATAATTCTAAA
AATGCAAATAATTTTACTGAGGAGATGTTGGCTGATTACAATAATAGATTAGAAATTCCT
ATCCCTAAAAATCGTTGGGATTCCCCTTTATTCCATTTGAGATCTAAAGAAGAAACTCCA
TTTGAAGAAATAGCTAATGTACTCTTATACTAGGCTAAGAAATCAAAAGATCCTGTTTCT
ACTGCTCCAGAAATAAAATTTGAGATTAATTTCTTGCAAGAATTAGATCTTAGAGTGCAA
AGTGTAATTGATGAACTTGTATAAAAATAATAAGAAAGCATCTAATCTAATGTTATTACT
TTCTCAGATTGTACTGAAAAGCTCATGATAAATAAATAAATTTCATTGATAGAACTCAAA
AAAATTAAATAAGAGTATTTAAAGATAACAAAGCACAATCCTCCTAAGAGAATTGAAGAT
ATCAAAAATTTCTTTATTATTTATCTTTAAAAAGTTGTAGAACGTTTTTGA


>TTHERM_01444910(protein)
MPLIVFCGIPGSGKTTRALQIKEYLEQKHKCQVVHLNEEILQMEKKEVYKDFQAEKFARG
FLRSNVEKNIAGNTVVILDSLNYIKGYRYELFCLARAAQTQHCVIYCECDPQLAKENNSK
NANNFTEEMLADYNNRLEIPIPKNRWDSPLFHLRSKEETPFEEIANVLLYQAKKSKDPVS
TAPEIKFEINFLQELDLRVQSVIDELVQKQQESIQSNVITFSDCTEKLMINKQISLIELK
KIKQEYLKITKHNPPKRIEDIKNFFIIYLQKVVERF


>TTHERM_01444910(gene)
ATGCCTTTAATAGTATTTTGCGGAATTCCAGGCTCAGGAAAGACAACAAGAGCTTTATAA
ATCAAGGAATATTTAGAATAGAAACATAAATGTTAGGTTGTTCATTTGAATGAAGAGATA
CTTTAAATGGAAAAGAAAGAAGTTTACAAAGGTACATAAAATATAAATTTATATTATCAT
ATTTAGTTTTTGTATTTTGCTACATCATCTCAATCAAACTCATTACTTTTTTACAGATTT
TTAGGCAGAAAAATTCGCAAGAGGATTCTTAAGATCTAATGTTGAGAAAAATATAGCTGG
AAATACAGTTGTGATTTTGGATTCACTAAATTATATAAAAGGTAGTCAAATTTATTAATT
CATTAAATATGATTTAGCTTAAAAATTTTAATTTCCTACAAACAGGTTATAGATATGAAT
TGTTTTGCCTTGCTAGAGCTGCTTAAACTTAACATTGTGTTATTTATTGTGAATGTGATC
CATAATTAGCAAAAGAAAATAATTCTAAAAATGCAAATAATTTTACTGAGGAGATGTAAT
TAATTCTATTCTATTTTATTATTTGTATTTTACAAAGGGAATATTAATTGAAATTATAAA
TATTCTAGGTTGGCTGATTACAATAATAGATTAGAAATTCCTATCCCTAAAAGTAATAAT
TTTATTTTAAAAAGGAATATATGTAAATTATTAATATAAATAAAGATCGTTGGGATTCCC
CTTTATTCCATTTGAGATCTAAAGAAGAAACTCCATTTGAAGAAATAGCTAATGTACTCT
TATACTAGGCTAAGAAATCAAAAGATCCTGTTTCTACTGCTCCAGTAAATAAAAATATAA
TAATTATTTGGATATTGAAAGATTACTTTTAACACATATTGATAAAATGAATGAATAAAA
ATCATATTGTTTTTACTTAATTAATTAGGAAATAAAATTTGAGATTAATTTCTTGCAAGA
ATTAGATCTTAGAGTGCAAAGTGTAATTGATGAACTTGTATAAAAATAATAAGAAAGCAT
CTAATCTAATGTTATTACTTTCTCAGATTGTACTGAAAAGCTCATGATAAATAAATAAAT
TTCATTGATAGAACTCAAAAAAATTAAATAAGAGTATTTAAAGATAACAAAGCACAATCC
TCCTAAGAGAATTGAAGATATCAAAAATTTCTTTATTATTTATCTTTAAAAAGTTGTAGA
ACGTTTTTGA