Identifiers and Description

Gene Model Identifier

TTHERM_00691520

Standard Name

KRS1 (lysyl-tRNA synthetase)

Aliases

PreTt02990 | 106.m00130 | 3674.m00043

Description

lysyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR02794 ) protein TolA
  • ( PF05386 ) TEP1 N-terminal domain
  • ( TIGR00499 ) lysyl-tRNA synthetase
  • ( TIGR00458 ) aspartyl-tRNA synthetase
  • ( TIGR00459 ) aspartyl-tRNA synthetase
  • ( PF01409 ) phenylalanyl-tRNA synthetase
  • ( TIGR00457 ) asparaginyl-tRNA synthetase
  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06975 ) Protein of unknown function (DUF1299)
  • ( PF00152 ) tRNA synthetases class II (D,
  • ( TIGR00462 ) lysyl-tRNA synthetase-like protein GenX
  • ( PF00587 ) tRNA synthetase class II core

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_149180
WormBaseWBGene000022389.997093137033517e-262locus:kars-1 Lysine--tRNA li
gase status:Confirmed UniP
rot:Q22099 protein_id:CCD691
80.1
Tetrahymena borealisEI9_17590.19.997093137033517e-262lysyl-tRNA synthetase (656 aa)
DictyBaseDDB_G02814379.997093137033517e-262lysS on chromosome: 3 position
4498697 to 4500739
OxytrichaContig16046.0.g669.997093137033517e-262tRNA synthetases class II (D,
K and N)
SGDYDR037W9.997093137033517e-262KRS1 Lysyl-tRNA synthetase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691520(coding)
ATGCACGCAATAAAAATTCTGTAAAATGCTGGCAGATTGCCAATTTTATAAAGATCGATT
TTGACAGGAAGAAATCTATAAATTGGAGCAATCAAAAAATTTAGATAATTTAATTTAGTT
TAATAAAACAAATATTTTTTCAGTTTAAACAACCAAGAGAATAACAGCAACAATAAATAA
TACTAAGAAATGGCTGACCAAAAACCCGAAGTTAAAAACGTCGAATAAGAAATCGAAACT
GGCGAAAGCAAGCAAAGAGAAGGTGAATCAAAGAACGCCTACAAGGCCAGACTAAAATAA
GAAAAGTTAGAAAAGGAAAAGGCTGAAAAGGCTGCTAAGAAGGCTGCTGAAGAAGCTGCT
AAGGGTGAAAAGGCTGCTACTAAGAAGGTCGATGAAGAAGAATTAGACCCTACTGCTTAC
TATGAAAATAGATGCAAGGCTGTCTAAGATTTAATGACCACTGGTAAGCCTTATCCTTAT
CCTCACAAGTTCGATGTTTCTCACAGCATCTCTCAATTTATTGAAGAATTCGACCCCAAG
CTCACTGAAAACGGATAAACTATTGACACCATCGTCACTATTGGTGCTAGAATTACCAGT
TTCCGTGCTTCTGGTAAGGCTCTCATCTTCTACCAAGTCTAACAAGAAGGCAAGAAGCTC
TAGGTCTTAGCCAACAAGAGCGTTTACACTGATGCTGAATACTCTTTTGAAGAAATCAAC
TCTCTTTTCAAGAGAGGTGATATCATTGGTATTACTGGTAAGCCCACTAGAAGTAAAACT
GGTGAATTGTCTATTGCTCCCACCAAGCTCTAACTCCTCTCACCTTGCTTACATATGTTA
CCCAGCTTACATACTGGTTTGAAGGATATGGAAACTAGATACAGAAAGAGATATTTGGAT
TTAATTATGAACAACAGTAGCAGAAACAACTTCATTACTAGAACCAAGATCATCAGCTAC
ATTAGAAGATACTTAGATGACAGAAATTTCCTTGAAGTCGAAACTCCCTAAATGAACATG
ATTCCTGGTGGTGCCGCTGCCCGTCCTTTCGTTACCCATCACAATGATTTGAATATGGAT
ATCTTCATGAGAATTGCTCCCGAATTATACTTAAAGAATTTAGTTGTTGGTGGTTTTGAA
AGAGTTTACGAAATTGGTAAATAATTCAGAAACGAAGGTATTGACAGAACTCACAACCCT
GAATTCACCTCCATTGAACTTTATCAAGCTTATGCTGATTACGAAGATATGATGAAACTT
ACTGAAGACTTATTGTCTTCTCTTGTTATGAAGCTTACTGGTTCTTACAAGATTAAGTTC
CACCCTGAAGGAAAGGAAAATCCCGATAACTCCTACGAAATCGATTTCACTCCTCCCTTC
AAGAGAGTTCCTATGATGGAAACCCTCAGTGAAAAACTCGGAGGTGTTAAAATGCCCGAA
AACTATGATACTGAAGAAGCCAGAGAATTCTTCGACAAGTTATGTGTTCAACACAATGTC
GCTTGCTCTGCTCCCAGATCTACTACCCGTTTGATTGACAAGCTCGTTGGTCACTTCATT
GAAGTTGACTGCAAGAATCCTACTTTTTTGATGGAACACCCTCAAATTATGTCTCCTCTT
GCTAAGTATCACAGATCCAAGCCTAACGTCACTGAAAGATTCGAACTTTTCGTTAACTAC
TACGAACTTTGCAATGCTTTCACTGAACTTAACGATCCCTTCAAACAAAGAAAGATCTTC
GTTCAACAAATTGAAGAAAAGAACAAGGGTGATGTTGAAGCTATGGGTTACGATAAAGAT
TTCTGTGATTGCTTAGAACATGCTTTACCTCCTACTGGTGGTTGGGGTTTAGGTATCGAT
CGTCTTGTTATGCTTCTTACTGATAACATCTACATCCAAGAAGTTCTCCTCTTCCCTGCC
ATGAAGCCTATCCTTGAAAACAAGAAAGAAGAAGAAGAAATTAAGGATAAAACTGAGTGA


>TTHERM_00691520(protein)
MHAIKILQNAGRLPILQRSILTGRNLQIGAIKKFRQFNLVQQNKYFFSLNNQENNSNNKQ
YQEMADQKPEVKNVEQEIETGESKQREGESKNAYKARLKQEKLEKEKAEKAAKKAAEEAA
KGEKAATKKVDEEELDPTAYYENRCKAVQDLMTTGKPYPYPHKFDVSHSISQFIEEFDPK
LTENGQTIDTIVTIGARITSFRASGKALIFYQVQQEGKKLQVLANKSVYTDAEYSFEEIN
SLFKRGDIIGITGKPTRSKTGELSIAPTKLQLLSPCLHMLPSLHTGLKDMETRYRKRYLD
LIMNNSSRNNFITRTKIISYIRRYLDDRNFLEVETPQMNMIPGGAAARPFVTHHNDLNMD
IFMRIAPELYLKNLVVGGFERVYEIGKQFRNEGIDRTHNPEFTSIELYQAYADYEDMMKL
TEDLLSSLVMKLTGSYKIKFHPEGKENPDNSYEIDFTPPFKRVPMMETLSEKLGGVKMPE
NYDTEEAREFFDKLCVQHNVACSAPRSTTRLIDKLVGHFIEVDCKNPTFLMEHPQIMSPL
AKYHRSKPNVTERFELFVNYYELCNAFTELNDPFKQRKIFVQQIEEKNKGDVEAMGYDKD
FCDCLEHALPPTGGWGLGIDRLVMLLTDNIYIQEVLLFPAMKPILENKKEEEEIKDKTE


>TTHERM_00691520(gene)
AGAAGATAAGTGTGACAATTAACAATATTAATATTTATTTTTTTAAAATATGCACGCAAT
AAAAATTCTGTAAAATGCTGGCAGATTGCCAATTTTATAAAGATCGATTTTGACAGGAAG
AAATCTATAAATTGGAGCAATCAAAAAATTTAGATAATTTAATTTAGTTTAATAAAACAA
ATATTTTTTCAGTTTAAACAACCAAGAGAATAACAGCAACAATAAATAATACTAAGAAAT
GGCTGACCAAAAACCCGAAGTTAAAAACGTCGAATAAGAAATCGAAACTGGCGAAAGCAA
GCAAAGAGAAGGTGAATCAAAGAACGCCTACAAGGCCAGACTAAAATAAGAAAAGTTAGA
AAAGGAAAAGGCTGAAAAGGCTGCTAAGAAGGCTGCTGAAGAAGCTGCTAAGGGTGAAAA
GGCTGCTACTAAGAAGGTCGATGAAGAAGAATTAGACCCTACTGCTTACTATGAAAATAG
ATGCAAGGCTGTCTAAGATTTAATGACCACTGGTAAGCCTTATCCTTATCCTCACAAGTT
CGATGTTTCTCACAGCATCTCTCAATTTATTGAAGAATTCGACCCCAAGCTCACTGAAAA
CGGATAAACTATTGACACCATCGTCACTATTGGTGCTAGAATTACCAGTTTCCGTGCTTC
TGGTAAGGCTCTCATCTTCTACCAAGTCTAACAAGAAGGCAAGAAGCTCTAGGTACTTAT
TTACTTAAATTTCATCTAACAAATTCATTTAAACAGGGTTTAGCTCAATAAAAAATTAGC
AAACCCATTTTCAAAAGATACAATTAAAATCTTCTTTTTATTAAATTTAACTTGTAAAAT
TTAAAAAATACGCCAAGATTTTTCTTTCAAACAAAACTTTAAGTTTTTTTTAAAAAATCA
AAAATAAAACGAAATGGCTTTAAATAATAGTAAATATGTCATTTTAATTTTCCATTTTAT
GTTAATAGGTCTTAGCCAACAAGAGCGTTTACACTGATGCTGAATACTCTTTTGAAGAAA
TCAACTCTCTTTTCAAGAGAGGTGATATCATTGGTATTACTGGTAAGCCCACTAGAAGTA
AAACTGGTGAATTGTCTATTGCTCCCACCAAGCTCTAACTCCTCTCACCTTGCTTACATA
TGTTACCCAGCTTACATACTGGTTTGAAGGATATGGAAACTAGATACAGAAAGAGATATT
TGGATTTAATTATGAACAACAGTAGCAGAAACAACTTCATTACTAGAACCAAGATCATCA
GCTACATTAGAAGATACTTAGATGACAGAAATTTCCTTGAAGTCGAAACTCCCTAAATGA
ACATGATTCCTGGTGGTGCCGCTGGTAATTATTATTAATTTATTTTTACTAAAACACAAA
TATAAAAGCATAGCAAAACAAACTAATAACACTCTTTTGTTTCATTCTTAGCAATGTTAA
TAGAGCAATTTTTAAAAAAATAAGCAATAAATATATAAAAAAATACAAGCAATCAAAATA
ATTCAAGCAATAAAATCAATCAATCTATTAATCTAGCATTATAAAATTATTTAGTTCTAC
AGCCTAATTAATATTTGATTTATATTTCTATTTAATTAATTATACTTTTAAATTATTAGC
CCGTCCTTTCGTTACCCATCACAATGATTTGAATATGGATATCTTCATGAGAATTGCTCC
CGAATTATACTTAAAGAATTTAGTTGTTGGTGGTTTTGAAAGAGTTTACGAAATTGGTAA
ATAATTCAGAAACGAAGGTATTGACAGAACTCACAACCCTGAATTCACCTCCATTGAACT
TTATCAAGCTTATGCTGATTACGAAGATATGATGAAACTTACTGAAGACTTATTGTCTTC
TCTTGTTATGAAGCTTACTGGTTCTTACAAGATTAAGTTCCACCCTGAAGGAAAGGAAAA
TCCCGATAACTCCTACGAAATCGATTTCACTCCTCCCTTCAAGAGAGTTCCTATGATGGA
AACCCTCAGTGAAAAACTCGGAGGTGTTAAAATGCCCGAAAACTATGATACTGAAGAAGC
CAGAGAATTCTTCGACAAGTTATGTGTTCAACACAATGTCGCTTGCTCTGCTCCCAGATC
TACTACCCGTTTGATTGACAAGCTCGTTGGTCACTTCATTGAAGTTGACTGCAAGAATCC
TACTTTTTTGATGGAACACCCTCAAATTATGTCTCCTCTTGCTAAGTATCACAGATCCAA
GCCTAACGTCACTGAAAGATTCGAACTTTTCGTTAACTACTACGAACTTTGCAATGCTTT
CACTGAACTTAACGATCCCTTCAAACAAAGAAAGATCTTCGTTCAACAAATTGAAGAAAA
GAACAAGGGTGATGTTGAAGCTATGGGTTACGATAAAGATTTCTGTGATTGCTTAGAACA
TGCTTTACCTCCTACTGGTGGTTGGGGTTTAGGTATCGATCGTCTTGTTATGCTTCTTAC
TGATAACATCTACATCCAAGAAGTTCTCCTCTTCCCTGCCATGAAGCCTATCCTTGAAAA
CAAGAAAGAAGAAGAAGAAATTAAGGATAAAACTGAGTGATTTTAATAAATAAAAACATG
AAGTTAGCGCTACTAAGCCATAATTATATTGTATATTAAAATATTAAAATAAATAAATCT
TTTTTAGTTGTTACTTATTGTCTACCTTAATAGTTAAATGCGCTAAAATAAATACTTATA
AAGTATAAATTAAAATAAATTTAATTATTTAT