Identifiers and Description

Gene Model Identifier

TTHERM_00185360

Standard Name

KRC2 (Fusion of a kinesin and RCC1 protein.)

Aliases

PreTt29858 | 14.m00425

Description

Fusion of a kinesin and RCC1 protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF00415 ) Regulator of chromosome condensation (RCC1)
  • ( PF08674 ) Acetylcholinesterase tetramerisation domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00185360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09928.19.997093137033517e-262kinesin motor domain-containin
g protein (1293 aa)
OxytrichaContig10272.0.g79.997093137033517e-262Kinesin motor domain
DictyBaseDDB_G02910392.998543574353313e-72kif11 on chromosome: 5 positio
n 4850945 to 4853002
Stentor CoeruleusSteCoe_381651.0648786602415064e-63
WormBaseWBGene000038845.002115178225629e-63locus:osm-3 Osmotic avoidanc
e abnormal protein 3 status:
Confirmed UniProt:P46873 p
rotein_id:CCD70203.1
SGDYGL216W9.998397555368434e-52KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00185360(coding)
ATGAAACCCATTAGAAGTAGTTCTTAAAAAAGTTTAGCAAATTCTGTAAATTCTAACAGA
GCTTCTGAATGTATATAAGTCTGCATAAGACTAAGGCCTCTTCTAAGACCTTAAGAGGAC
GAAGAAGCCTGGGATATAAATAAAAAAACTTAATAAATTTATTCTTTAATTGATCAGAAA
TCTTCTTTAGTGACAAATAATGAAATTACTGAAAACATGTCTTTAAAAGATAGAAAGCGC
TTAATCGAAGCAGGGAATAATTCAATATTTTTTACATTTGATAACATGGAAGGACCAGAA
GTCAGAACTCAAACTATTTATAATAAAATGGGTAAACATATCATCAATTCTGTTTTAGAA
GGTTATCATGGATCTATATTATGTTATGGATAAACTACTTCAGGAAAAACGTTTACTATG
TTAGGTTAACCAGAAAACCCTGGTATTCTACCTTGTAGTATAAGAGATATGTTTAATTTA
ATTTAAAAATAAGCTAATGAGGAATTTAATGTTTGGGTTAGTTATATGGAAATTTATAAT
GAAAATATTAATGATTTGTTGGCTCCCTAACAATAAAACCTTAAAATTATTGAAGATTCA
AAGTGGGGGACTATTGTCCAAGGACTTAAAATGCAAAGAGTTTGGAATTTTGAATAGGCT
ATTGTCTTGATGAACTATGGCGAAGAGCATAGAAAATATCGTGAGACATCAATCCATGAG
CACTCTTCTAGGTCTCACACAGTCTTCAAAATATATTTGGAAAGTTTTAGTAAAGACCTC
AACTCTGGATACAAAAAGACAAGGTATTCATGCTTGAATCTAGTTGATCTAGCTGGATCA
GAGAGATTATCTGAAATAGATTTTAACCCAAATACTTTAGGAGAAACTGGTTATATTAAT
AAAAGTTTATTTATTTTAGCGAATTGCATAAATAAGTTAGCAGAAGGTAAAAAACAACAT
ATCCCTTATAGAGACTCTAAACTAACAAGAATATTAACTTAGGCTTTGGGTGGTAATTCA
TTTACTTCAATTATTTGTTGTGTTTCTCCTGCAGTTTGCAATTTTAATTAAACTTTATCA
ACACTAAGATTTGCTACTAGGGCTAAAATTATATAAAATAAACCAATAATAAATGAAATT
GGAGATGACATTAGTGATAATTAATCTGTTAGCTTCAATGAATATAAAAAATTAGAAGAA
AATTTAGGCTAACAACTAAAAGAAAATCAAACTCTTTCACAATAAAACATTCAATTAAAA
AATGAAATTTCTTTGCTACAGAATAAAATGGCAGATATGTCTTTTGAACTGAATGAGTTG
ATGAATTCAATCACTTTAGAAAGAAAAAAATCTGAAGCTTTAGAATAAGATTCAAAGAGA
TAAAAAATAACTTCAGGGAATGATTTACTTTAATAATCGAATTAAGAACCAGCATCAATA
AACCATTAAGATAAGCTTTAAAATAGCTTATTAAAAAATATTAACAACGAGTAGACATTT
TTAGAAAATGCTATTAACCTCGTAATCCCTATGATTAAAGAAGCTCTTCAGTTAAAAACT
CAAGATATATCTCATGAAATGGAATACTTCTATGTTGAAAGTAAAAAGATAGCATAGCTT
TATCAAAAAGAATTGTACACATTATAAAATAAATACTCAGAGGGTATTAAGCAGATTGTT
AAATAAATATGCTAAGAAGAGAAATAATTTTTACCAATAAAATCTTTCGTAGAGACTTTG
AGCACTCTCAATAGCATCAGCTAATAGAATTGGGAAAATAAAGATTTTTAGAAAAAAGGG
TCCTAGGCAGCTAATGAGGGATTAGATAAATAAGTTTAAAGAAAGCAAAACGCTAGTAAT
TAAGAGGAAGAAAATGATGAAGTTTTGTAGAGTGGAAGGATTCTTATATAAAAAATAGAA
GAAAAGTAGCTATTTAGAAATATTTAATATAGCTTTATGGATATAATAAATTAATTAGAG
CTTAAAGAAAGTATGAATGAGTAATAAATATAAATTATTTTATTTTCTCTTAAGAATCAA
TACGATTAGCTTTAGAAGTAATATGATGATGAATATGAAAAATATAGAAATGAGCTAGAG
TTCTTTTACAGAAGAAAAATTAGTGTCATCAAAAATTAACAGATTTCTGGTTATAATTCT
ATATCTCTTTTGTAAGAAATCACTTAAGATCATGAAAGCAAATTAACCATTTTAAGACAT
ATATACGAATAAGAAAAGAATCATCTGGAATAAGCTTATATTGCTACTATTAAGCAAATC
GAAGACTGTATTCATAGAAATTCGTATGGTAGCATTCCCTATAACAATTAAGAAGTGTAC
AAATTAAGCAATGGTAATCTTAAAGAAGCTGGATACTTTAGAAATTATGATGAAAGTTAA
ACAGAAAACTCTCTTTAATACGATTCAAGTTATGCGTCTAGCATTAATTAAAGTGGGATG
TCTAAAGCAGGAGACAACTCACTTCATAGAAAAGATATAAACAGTTAAAAGTTTTTGTAA
GCTAATAAGCAGCAATAGGCACTTTTTAAAACACCGAAATTCGATTAATTTATTATAAAT
CAAAACAATTCTACAAGATCAAATGAACCAAATAGGATACAAAACGAATTAGAAAGTCAA
ATAACCCTCTAAAAGCCATAATATAATGGCATCATTTACATATGGGGTAATGGTAAAGAT
GGTAGATTAGGAATAGAAGGAGAAAAACCTTTTAAATTCCCACAAATTATACCTAATATT
TAAGCCTGTTAAGTGAGTCTTGGCTATCACCATTCAGCTTGTATCTCAAATTAAGGTTAA
ATTCTTACATGGGGTAGAGGAAATAGAGGGCAATTAGGACATTCTAGTTTTGAAAACTGT
CTTTTACCAACACCTGTCAATTTCTTTAGCAAGATGTCCATAGTCAGTGTTGGTTGTGGA
TGGTAGCATACTTTAGCACTCAGTAATGATGGACGAGTTTTTTCATGGGGGTTTGGAGAA
GATGGATAACTTGGTTTGGGTGATTATTAAAGTCAAAATAGTCCTTAATTTATAAACTCA
CTAGAAGGGTATTTTGTAACTTAAATTAATGCAGGTCACAGTCATTCTTCAGTAATTACC
TCAGAAGGTATTTTCATGATGTTTGGCTGTAATATAGACCATAGATTAATGAATAAAACT
AATTAAAACTAATTTTTGCCTTGTATAACTGAGCTTGAATTTTTAAGATAGGAATACGGC
TCTGATTATAATGCTGTTAAGGCATCTTTAGGTGTCAATCACTCTGCTGTGATAACAAAA
AATGGAAATTTATATACAAGTGGCCTTGGAAATGAAGGTCAACTAGGCAGTTTTATAAGT
GAAGATACTCCTAATAGTTTGATGATTTAAAAAAATAGCAACGAAATGAGTGAATATTCT
AAATTTGAAGAAGAACAATAAGAAAATTAAGATTAATTTGATAGAATATGTTACTTTAAC
AAAGTCAATTTCTTCAACAAGAAAAATAAAGCAATTTAAGTATCTTGTGGCGATAGCTTT
ACATTAGTAATAAATGAGTAAAGCTAAGTATATTCTTTTGGTAAGGGTTCGTATTATAGG
TTAGGTCATTTAGATATACAAACAAATCAAAATGTATATGAGCCTAAATTAATAGAATCG
CTTAAAAATTTCAAAATAACTTCTGTTTCAACAGGATGTAGACACGCTGTAGCAATAACA
AATGACGGTAAAGTATATACTTGGGGATTCAATTTCTATGACCAGCTTGGTCTTGGTGAC
TCTGAGAAAGATTATCAACAGCCTACCAAGGTAACAAAACTTAGCGGATTAAATGTAAAA
TAAAGTAGCTGTGGATATTTCCACACCTCAGTCTTAGTTGTCTGA


>TTHERM_00185360(protein)
MKPIRSSSQKSLANSVNSNRASECIQVCIRLRPLLRPQEDEEAWDINKKTQQIYSLIDQK
SSLVTNNEITENMSLKDRKRLIEAGNNSIFFTFDNMEGPEVRTQTIYNKMGKHIINSVLE
GYHGSILCYGQTTSGKTFTMLGQPENPGILPCSIRDMFNLIQKQANEEFNVWVSYMEIYN
ENINDLLAPQQQNLKIIEDSKWGTIVQGLKMQRVWNFEQAIVLMNYGEEHRKYRETSIHE
HSSRSHTVFKIYLESFSKDLNSGYKKTRYSCLNLVDLAGSERLSEIDFNPNTLGETGYIN
KSLFILANCINKLAEGKKQHIPYRDSKLTRILTQALGGNSFTSIICCVSPAVCNFNQTLS
TLRFATRAKIIQNKPIINEIGDDISDNQSVSFNEYKKLEENLGQQLKENQTLSQQNIQLK
NEISLLQNKMADMSFELNELMNSITLERKKSEALEQDSKRQKITSGNDLLQQSNQEPASI
NHQDKLQNSLLKNINNEQTFLENAINLVIPMIKEALQLKTQDISHEMEYFYVESKKIAQL
YQKELYTLQNKYSEGIKQIVKQICQEEKQFLPIKSFVETLSTLNSISQQNWENKDFQKKG
SQAANEGLDKQVQRKQNASNQEEENDEVLQSGRILIQKIEEKQLFRNIQYSFMDIINQLE
LKESMNEQQIQIILFSLKNQYDQLQKQYDDEYEKYRNELEFFYRRKISVIKNQQISGYNS
ISLLQEITQDHESKLTILRHIYEQEKNHLEQAYIATIKQIEDCIHRNSYGSIPYNNQEVY
KLSNGNLKEAGYFRNYDESQTENSLQYDSSYASSINQSGMSKAGDNSLHRKDINSQKFLQ
ANKQQQALFKTPKFDQFIINQNNSTRSNEPNRIQNELESQITLQKPQYNGIIYIWGNGKD
GRLGIEGEKPFKFPQIIPNIQACQVSLGYHHSACISNQGQILTWGRGNRGQLGHSSFENC
LLPTPVNFFSKMSIVSVGCGWQHTLALSNDGRVFSWGFGEDGQLGLGDYQSQNSPQFINS
LEGYFVTQINAGHSHSSVITSEGIFMMFGCNIDHRLMNKTNQNQFLPCITELEFLRQEYG
SDYNAVKASLGVNHSAVITKNGNLYTSGLGNEGQLGSFISEDTPNSLMIQKNSNEMSEYS
KFEEEQQENQDQFDRICYFNKVNFFNKKNKAIQVSCGDSFTLVINEQSQVYSFGKGSYYR
LGHLDIQTNQNVYEPKLIESLKNFKITSVSTGCRHAVAITNDGKVYTWGFNFYDQLGLGD
SEKDYQQPTKVTKLSGLNVKQSSCGYFHTSVLVV


>TTHERM_00185360(gene)
ATGAAACCCATTAGAAGTAGTTCTTAAAAAAGTTTAGCAAATTCTGTAAATTCTAACAGA
GCTTCTGAATGTATATAAGTCTGCATAAGACTAAGGCCTCTTCTAAGACCTTAAGAGGAC
GAAGAAGCCTGGGATATAAATAAAAAAACTTAATAAATTTATTCTTTAATTGATCAGAAA
TCTTCTTTAGTGACAAATAATGAAATTACTGAAAACATGTCTTTAAAAGATAGAAAGCGC
TTAATCGAAGCAGGGAATAATTCAATATTTTTTACATTTGGTAAAACATTTACATTTTTA
CTGTTTGTTAAGAGGTTTAAAATAAAATCTGTTTGGATTTAATCATATTCAGTATAATTA
TAATTGGCAGTAGTAACTAATAATAATTGATGTTAAAATTAGATAACATGGAAGGACCAG
AAGTCAGAACTCAAACTATTTATAATAAAATGGGTAAACATATCATCAATTCTGTTTTAG
AAGGTTATCATGGATCTATATTATGTTATGGATAAACTACTTCAGGAAAAACGTTTACTA
TGTTAGGTTAACCAGAAAACCCTGGTATTCTACCTTGTAGTATAAGAGATATGTTTAATT
TAATTTAAAAATAAGCTAATGAGGAATTTAATGTTTGGGTTAGTTATATGGAAATTTATA
ATGAAAATATTAATGATTTGTTGGCTCCCTAACAATAAAACCTTAAAATTATTGAAGATT
CAAAGTGGGGGACTATTGTCCAAGGACTTAAAATGCAAAGAGTTTGGAATTTTGAATAGG
CTATTGTCTTGATGAACTATGGCGAAGAGCATAGAAAATATCGTGAGACATCAATCCATG
AGCACTCTTCTAGGTCTCACACAGTCTTCAAAATAGTAAAGAATATTTTTTTAATTGTTA
ATTAATTAACTTTTTATTCATTCATACCTAAATTAATTTTTTCCATCATATTTTATAGTA
TTTGGAAAGTTTTAGTAAAGACCTCAACTCTGGATACAAAAAGACAAGGTATTCATGCTT
GGTAATACATTTTTTATTTTTTCAATAAAATCAATTCATTAAAAGTTAAAAATAAATAAA
TAAATAAATTATTTACAGTAAAACTTCATTTAGCTTAATTCCTCAATAAAAGATAGCAAT
CTATTAATATGTTAAAAATAAATACAAGTATGGTTGATGGTCATAAAAGAATTAAATAGA
TTTTCCAATAATGATCGATCTATATTAAATAAATTAAAAAAAAGAATTTTTGTTTCATTG
ATTTTTAAGGATTGAAAAAAAATTTTATTTTTTATTAAATAAATATAACAATAAGATACG
ATTAAATGATGTTCTGTTATTGATTAAAAATTAAATATTAAATAAATTTAATTTAGAGAT
TAAAACAAATGCAATTAAATAAAAACTAATAAATTTTTTATATAAATTAGAATCTAGTTG
ATCTAGCTGGATCAGAGAGATTATCTGAAATAGATTTTAACCCAAATACTTTAGGAGAAA
CTGGTTATATTAATAAAAGTTTATTTATTTTAGCGAATTGCATAAATAAGTTAGCAGAAG
GTAAAAAACAACATATCCCTTATAGAGACTCTAAACTAACAAGAATATTAACTTAGGCTT
TGGGTGGTAATTCATTTACTTCAATTATTTGTTGTGTTTCTCCTGCAGTTTGCAATTTTA
ATTAAACTTTATCAACACTAAGATTTGCTACTAGGGCTAAAATTATATAAAATAAACCAA
TAATAAATGAAATTGGAGATGACATTAGTGATAATTAATCTGTTAGCTTCAATGAATATA
AAAAATTAGAAGAAAATTTAGGCTAAGTAAGAATATATTTATTAATTTATTTATAGCTAT
TTAATATATATTTATTTAAACTCTAAATAATATGAACAGCAACTAAAAGAAAATCAAACT
CTTTCACAATAAAACATTCAATTAAAAAATGAAATTTCTTTGCTACAGAATAAAATGGCA
GATATGTCTTTTGAACTGAATGAGTTGATGAATTCAATCACTTTAGAAAGAAAAAAATCT
GAAGCTTTAGAATAAGATTCAAAGAGATAAAAAATAACTTCAGTAACTAATATTTAGATT
AAAAAACAAATCAAATTCCTTTATGATTAATTGATTTATTTATTTTTTATTATAATTATT
TATTAGGGGAATGATTTACTTTAATAATCGAATTAAGAACCAGCATCAATAAACCATTAA
GATAAGCTTTAAAATAGCTTATTAAAAAATATTAACAACGAGTAGACATTTTTAGAAAAT
GCTATTAACCTCGTAATCCCTATGATTAAAGAAGCTCTTCAGTTAAAAACTCAAGATATA
TCTCATGAAATGGAATACTTCTATGTTGAAAGTAAAAAGATAGCATAGCTTTATCAGTAA
ATTGAGCTTTGATAATATCAAAATATATTTCTATTTAATTGAAATTTTATTCTTTTTAAG
TAAACAAAAAACATGTTTAAAGAATAAATAAAATTATCTATTCAAGATAATCAAAATTTT
ATAAAAATTTACAAAAATGTTATTTTCTTTGAAATTTTTATTAATAATTAAATAAACCAA
TTATTTACTTACAAAAATAGAAAAGAATTGTACACATTATAAAATAAATACTCAGAGGGT
ATTAAGCAGATTGTTAAATAAATATGCTAAGAAGAGAAATAATTTTTACCAATAAAATCT
TTCGTAGAGACTTTGAGCACTCTCAATAGCATCAGCTAATAGAATTGGGAAAATAAAGAT
TTTTAGAAAAAAGGGTCCTAGGCAGCTAATGAGGGATTAGATAAATAAGTTTAAAGAAAG
CAAAACGCTAGTAATTAAGAGGAAGAAAATGATGAAGTTTTGTAGAGTGGAAGGATTCTT
ATATAAAAAATAGAAGAAAAGTAGCTATTTAGAAATATTTAATATAGCTTTATGGATATA
ATAAATTAATTAGAGCTTAAAGAAAGTATGAATGAGTAATAAATATAAATTATTTTATTT
TCTCTTAAGAATCAATACGATTAGCTTTAGAAGTAATATGATGATGAATATGAAAAATAT
AGAAATGAGCTAGAGTTCTTTTACAGAAGAAAAATTAGTGTCATCAAAAATTAACAGATT
TCTGGTTATAATTCTATATCTCTTTTGTAAGAAATCACTTAAGATCATGAAAGCAAATTA
ACCATTTTAAGACATATATACGAATAAGAAAAGAATCATCTGGAATAAGCTTATATTGCT
ACTATTAAGCAAATCGAAGACTGTATTCATAGAAATTCGTATGGTAGCATTCCCTATAAC
AATTAAGAAGTGTACAAATTAAGCAATGGTAATCTTAAAGAAGCTGGATACTTTAGAAAT
TATGATGAAAGTTAAACAGAAAACTCTCTTTAATACGATTCAAGTTATGCGTCTAGCATT
AATTAAAGTGGGATGTCTAAAGCAGGAGACAACTCACTTCATAGAAAAGATATAAACAGT
TAAAAGTTTTTGTAAGCTAATAAGCAGCAATAGGCACTTTTTAAAACACCGAAATTCGAT
TAATTTATTATAAATGTAAGTAATTTACATTAAATAAATATTTTTATAAAATTATTTGTA
AATTTATAAATTTTTTTTAGCAAAACAATTCTACAAGATCAAATGAACCAAATAGGATAC
AAAACGAATTAGAAAGTCAAATAACCCTCTAAAAGCCATAATATAATGGCATCATTTACA
TATGGGGTAATGGTAAAGATGGTAGATTAGGAATAGAAGGAGAAAAACCTTTTAAATTCC
CACAAATTATACCTAATATTTAAGCCTGTTAAGTGAGTCTTGGCTATCACCATTCAGCTT
GTATCTCAAATTAAGGTTAAATTCTTACATGGGGTAGAGGAAATAGAGGGCAATTAGGTA
AATTTTTATATCTTATTAAATTCTTCAATAAATATTTATTTATTAAAAGGACATTCTAGT
TTTGAAAACTGTCTTTTACCAACACCTGTCAATTTCTTTAGCAAGGTAAAAATATATTTT
TTAATTATTTGACATTAATAGATATATATTTATCTACATATTATTACTGCAAACTTTAAG
AACTTATATAAATTACTATTTTTAAGCTCTTTAATTTTTATTATTTTTAAAAAATAACGA
TTAATGAGATAAATATAAAAATTATTTTCAGAAAAAAGAAAAAATAAGGTTTATAAGTAA
CTAACTTAATGAATTCAATAAAAAAATTAAATTAAAATAGATGTCCATAGTCAGTGTTGG
TTGTGGATGGTAGCATACTTTAGCACTCAGTAATGATGGACGAGTTTTTTCATGGGGGTT
TGGAGAAGATGGATAACTTGGTTTGGGTGATTATTAAAGTCAAAATAGTCCTTAATTTAT
AAACTCACTAGAAGGGTATTTTGTAACTTAAATTAATGCAGGTCACAGTCATTCTTCAGT
AATTACCTCAGAAGGTATTTTCATGATGTTTGGCTGTAATATAGACCATAGATTAATGAA
TAAAACTAATTAAAACTAATTTTTGCCTTGTATAACTGAGCTTGAATTTTTAAGATAGGA
ATACGGCTCTGATTATAATGCTGTTAAGGCATCTTTAGGTGTCAATCACTCTGCTGTGAT
AACAAGTAATTATTTTAATTTAATTTCTTTAAAAACAAAAAAATCTTTTACATCCTAATA
GAAAATGGAAATTTATATACAAGTGGCCTTGGAAATGAAGGTCAACTAGGCAGTTTTATA
AGTGAAGATACTCCTAATAGTTTGATGATTTAAAAAAATAGCAACGAAATGAGTGAATAT
TCTAAATTTGAAGAAGAACAATAAGAAAATTAAGATTAATTTGATAGAATATGTTACTTT
AACAAAGTCAATTTCTTCAACAAGAAAAATAAAGCAATTTAAGTATCTTGTGGCGATAGC
TTTACATTAGTAATAAATGGTATGCATTTATTTTTCTTTGTAATTTTAAGAGATTTTTTA
TTATATTTTTTATATTAAAAGAGTAAAGCTAAGTATATTCTTTTGGTAAGGGTTCGTATT
ATAGGTTAGGTCATTTAGATATACAAACAAATCAAAATGTATATGAGCCTAAATTAATAG
AATCGCTTAAAAATTTCAAAATAACTTCTGTTTCAACAGGATGTAGACACGCTGTAGCAA
TAACAAATGACGGTAAAGTATATACTTGGGGATTCAATTTCTATGACCAGCTTGGTCTTG
GTGACTCTGAGAAAGATTATCAACAGTAAAATATTCTTTTTAAAAATATTATTAACAATT
AAAAACAAAAAAAGGCCTACCAAGGTAACAAAACTTAGCGGATTAAATGTAAAATAAAGT
AGCTGTGGATATTTCCACACCTCAGTCTTAGTTGTCTGA