Identifiers and Description

Gene Model Identifier

TTHERM_00721710

Standard Name

KRC1 (Fusion of a kinesin and RCC1 protein.)

Aliases

PreTt18479 | 115.m00135

Description

Fusion of a kinesin and RCC1 protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF05267 ) Protein of unknown function (DUF725)
  • ( PF00415 ) Regulator of chromosome condensation (RCC1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00721710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17440.19.997093137033517e-262kinesin motor domain-containin
g protein (1346 aa)
OxytrichaContig10272.0.g79.997093137033517e-262Kinesin motor domain
DictyBaseDDB_G02851011.99927841627239e-68kif4 on chromosome: 4 position
2856191 to 2862064
WormBaseWBGene000022307.997312755134699e-60locus:klp-20 status:Confirme
d UniProt:Q965T6 protein_i
d:CCD73793.1
SGDYBL063W4.000521932330652e-52KIP1 Kinesin-related motor pro
tein required for mitotic spin
dle assembly, chromosome segre
gation, and 2 micron plasmid p
artitioning; functionally redu
ndant with Cin8p for chromosom
al but not plasmid functions
Stentor CoeruleusSteCoe_381651.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00721710(coding)
ATGAAGAACAATAATAGATCTAAATCTCCTATTAATGGAGGAGGAAGTACTTATTCGTAA
GGAAGTGTACATAAAAAATCATAGCAATAACAATCATCTGTATAATAGTAATAGGACTCA
TCTTATTCAATATAAATTTCTGTGCGTATGAGACCTCTGCTTTAGGATTTTGAAGATGAA
GTCTCTTGGATAGTTGATAAATAAAATAAAAGTATACAAAGCCAAACCCAAAAGAACTTA
GCTTAGTCGATGAATGGAAATTCTAATTTATTAGCAGAATCTACTTCACTAACTCCAACA
AATGGTTAGTAGGGAAAAGGAAAATTAATGACAATGTCAACAATGAGCTAAGATTAACTT
GCCATAATGAGGAGGAGATATGCAGATGCGTATTACAATTACTCTTTTAACTTTGATCAA
GTATTTAGTCCTTAAGAAAGCACAGAATCTATATACAATTCAAGCTGCAAAAATATTGTT
TACAGTGTTTTAGATGGATACAACAGTACAATCTTTATGTATGGCTAGACAACATCAGGT
AAAACTTTTACGATGCTAGGAGATATGGACAATCCAGGTGTGCTTCCTTACTCTCTTCAT
GATATTTTTGATGAAATAGAAAAGAGAAAAAAGGAGCAGGAGGTTGAATATCAAGTGCTA
GTTAGCTATATAGAAATTTACAATGAGTAGATTAACGATCTTATAAATCCTGGAATGACC
AACTTAAGAATTCATGATGACCCAAAAATTGGACCTATTGTTTAAGGAATGAAGCAATGT
GAAGTTACTAATTTTAATGAAGCTATTATTTTAATGAGGTTTGGAGAAGAGCATCGTTGT
TACAAGGAAAAGAATATACATGAACACTCTTCCAGATCCCACACAATATTTTAGTTAAAA
GTCCTTTCTAAGAGTAAAAAAGAAAATAACTAATATTCCACCAAAGCAGCTGTTTTAAAT
CTAGTGGATCTTGCTGGTTCAGAAAGGCTTCATGAAGAAGACTCTAAAAGTGGTAACAAT
GAAGAAACAGGTTTCATAAATAAAAGTCTATTTGTGCTTTCTAATGTCATAAACAAGCTT
GCTGAAGGAAAATCAAATAAATACATTCCTTTTAGAGATTCGAAACTAACTAGATTCCTT
TCAAATGCGCTTGGTGGCAATTCTATGACAGCTATTATTTGCACTATTTCTCCAGCTGCT
ATGAATTTCTATCAAACACTAAGTACCTTGAGATTTGCTACGAGGGCAAAAAAGGTTTAC
ACTACTCCTGTTGTTAATGAAATTAAACATCCAAGAGATATTGGTGAGATTAATAAAGAG
ATTGATGAACTTAATTAACGTCTTATAGCTAAGAATACTGAAATAGAAATGATGTAGAAA
GATAAGATTTTCTTAGAAAACACTTTAGTGGAGTCAACAAAATAAATTAATTTACTAAAT
AAGGAAATTAAAAAAATAAAATCTAAATAAAATTTGGAAGATGATTATTCGCTGCAATAC
TAGCAGCTATTAAATGATAATAATTTTATTGATATTTTAGCATAAAGAGTGGAATTATTT
TTGTGGGATGATTACAATTTAAGCACTAATAATTCGAGAGATGAAGACTATTCAGACTTA
GAAGATGAGAAAATGAAGAAAAAAAACAAATAAATAGATGAAGACGACAGAAATATCGGT
TCTAAATTGAAGGACAATATTAAAGAGAATTTCGAGTAATGTCATGCTGAGTGGAGCAAA
ATGCAATAAAAACTTGTAAATCGTTATAAATAAGATGTTTAAAATTTATAGATGAAGTAC
AAAGACGAAATAAAAAATATGAGCAGATTTTACATGAAAGAAACAAAGTAAAACGAAAAA
GAACTCGAGGATATTATTTAAAACAGAGACGAACTTAAAATGATAAAAACTTTAGAAAAG
CAGATTGAAAAAAAAATAGATAACAATACTATTTTCAATGGAATAGCTGTTAATATAATT
TTAGATCCTCAACTGCCTATTGAGTTAGATACAGCTGAGGAAATAGAGTAATATGCAGTC
AATGTAAAAGCTGCCTATTAAGAAGCTTCTTAATCATTGGAATAAAAGTTTAAAGACTAT
AAATCTCTCCTTTCTAACATTTGCAAGACACAGATAAAATACTTCGCTTAATCAAGTAGC
AATCATAATCATTTAAATAATAAAAATTATGTAAATGATAATAATAAGCTATCGTCAAGT
ATATAAAAGTTAACTTCTAGACATTCTGAAATGCTTCAAAAATTGACAGTTCTTTTTTCA
AATAAATCATCCATACTCGAATCTGTTTATATTCAGGTTTGTTAAAATTTAGATATTAAT
CCAGGATAGATTTTCTTACCAACAACGAGATCAGCTACAAGCACATCATAGTTTTCTAAT
ATTACTGATAATAGGGTTCCATTTGCAGACTAAAGTTCAGTAGCAAATATCTTAAAATAA
AATTACTCAAAGTACCCTCCATCCTACGCAGTCAATAGCATTTAAGGAGATAAGTAAATA
ATAAATAACACTCCAAAATTTGAAGAATTTCTTTCCAACAAAAGACAAATCACAAATAAA
CAAATCACAGATTTTCTTGATTTAGAGGAGTTCTCTTCAATTTCTGAGAGAGAAAATCAT
TAGGTTCATTAAAAGAATGGTTCAATGGAATATAACAGATCATATTAACATTAAAATTAA
TCTTCTATCCTCTAAAAAAAATAATAGAGTACTTTCGATTAGCTAAAATCAAAACCTGAT
GGTTCTATTATTACTTTTGCATGGGGTTCTGGCAAGGATGGAAGATTGGGATTAGGTACT
GATAGAGGAGAAAGCAATCCAACGATGCTAAATAGCCAATAATTCATATATTTATCTTGT
GGTTATTATCACACTGCAGGAATAACTGAAAAAGGAGAATTATATCTTTGGGGAAAAGGT
AATAGTGGTTAACTAGGTAATTCTAGTTTTAATAGCTCAAAAGTTCCTATCTTAGCGAAC
ATCCCACAAACTATACCCATAGTATAGGTAGTATGTGGATGGTAGCATAGCATGGCTTTA
TCTTCAAGTGGATAAGTTTATTCTTGGGGATTAGGAGAAGAAGGATAATTAGGGCATAAT
GACATGGAAACCCTTAATACTCCTAAAATGATAGAATATTTTTCTTAATAGGCCAAACAA
ATTAAATATATTTCCTGTGGGCATTCTCATTCTGCCGCCATTTCAGAAGAAGGAGATTTA
TACACTTGGGGTTGCAACTATGACTATAGACTAATGATAAATGAAAATAAAAATTAATAT
AAGCCTGTTCTCACATAGTTACATTATCTCAAGGAGATTTACTAAAAAAGTGGATAAGAT
ATTTCTTAAAAGTTTAATGTTTAATTAGTTTCATTAGGAGTTAACCACACAGCTGTTATA
ACAGTTGATGGTAGTGTCTATACTGCTGGTTTAGGTAATCATGGAGAACTTGGAATCATT
TTGAATGAATCAGTTCCTAACACAGATATAATAAGAGATATAGTATGTTAACAAAATAGT
AATAATGTAGAAGAGCGATGCTGTTATTTACATAAAGTTTAAACTTTTGGCGAGGAAAAT
AAAGCAATAGATATCGCATGTGGCTATGAATTCACTATTGTATTAAATGCAGAAGGGACA
GTTTACTAATTTGGTAAAAAAATTTCTCAAGGACCTGATTTTATAGGAACTAAGCAGGAA
ATTCAAGATTATGTAACAAAAGATTCATAAAATGTCACTCCTTAAATTATGTATGAGTTT
GGAAATATCCGAGTACAACAAATTGCTGCTGGAAAAAACCACATTGCAATAATAACTGAA
AATGGAGAATTGTATACTTGGGGGAAAAATTTCTATGATAAACTAGATATGGGGGACGAT
AAACATGAAAGCAACAAACCTGTTAAATTATTTGAAGGAATTAATAACTTGCAATGTATT
TAAGTATCTTGTGGTGAATTTCATTCTGTTTGCTTAAATAAGTGTTAAAAAAAGTGA


>TTHERM_00721710(protein)
MKNNNRSKSPINGGGSTYSQGSVHKKSQQQQSSVQQQQDSSYSIQISVRMRPLLQDFEDE
VSWIVDKQNKSIQSQTQKNLAQSMNGNSNLLAESTSLTPTNGQQGKGKLMTMSTMSQDQL
AIMRRRYADAYYNYSFNFDQVFSPQESTESIYNSSCKNIVYSVLDGYNSTIFMYGQTTSG
KTFTMLGDMDNPGVLPYSLHDIFDEIEKRKKEQEVEYQVLVSYIEIYNEQINDLINPGMT
NLRIHDDPKIGPIVQGMKQCEVTNFNEAIILMRFGEEHRCYKEKNIHEHSSRSHTIFQLK
VLSKSKKENNQYSTKAAVLNLVDLAGSERLHEEDSKSGNNEETGFINKSLFVLSNVINKL
AEGKSNKYIPFRDSKLTRFLSNALGGNSMTAIICTISPAAMNFYQTLSTLRFATRAKKVY
TTPVVNEIKHPRDIGEINKEIDELNQRLIAKNTEIEMMQKDKIFLENTLVESTKQINLLN
KEIKKIKSKQNLEDDYSLQYQQLLNDNNFIDILAQRVELFLWDDYNLSTNNSRDEDYSDL
EDEKMKKKNKQIDEDDRNIGSKLKDNIKENFEQCHAEWSKMQQKLVNRYKQDVQNLQMKY
KDEIKNMSRFYMKETKQNEKELEDIIQNRDELKMIKTLEKQIEKKIDNNTIFNGIAVNII
LDPQLPIELDTAEEIEQYAVNVKAAYQEASQSLEQKFKDYKSLLSNICKTQIKYFAQSSS
NHNHLNNKNYVNDNNKLSSSIQKLTSRHSEMLQKLTVLFSNKSSILESVYIQVCQNLDIN
PGQIFLPTTRSATSTSQFSNITDNRVPFADQSSVANILKQNYSKYPPSYAVNSIQGDKQI
INNTPKFEEFLSNKRQITNKQITDFLDLEEFSSISERENHQVHQKNGSMEYNRSYQHQNQ
SSILQKKQQSTFDQLKSKPDGSIITFAWGSGKDGRLGLGTDRGESNPTMLNSQQFIYLSC
GYYHTAGITEKGELYLWGKGNSGQLGNSSFNSSKVPILANIPQTIPIVQVVCGWQHSMAL
SSSGQVYSWGLGEEGQLGHNDMETLNTPKMIEYFSQQAKQIKYISCGHSHSAAISEEGDL
YTWGCNYDYRLMINENKNQYKPVLTQLHYLKEIYQKSGQDISQKFNVQLVSLGVNHTAVI
TVDGSVYTAGLGNHGELGIILNESVPNTDIIRDIVCQQNSNNVEERCCYLHKVQTFGEEN
KAIDIACGYEFTIVLNAEGTVYQFGKKISQGPDFIGTKQEIQDYVTKDSQNVTPQIMYEF
GNIRVQQIAAGKNHIAIITENGELYTWGKNFYDKLDMGDDKHESNKPVKLFEGINNLQCI
QVSCGEFHSVCLNKCQKK


>TTHERM_00721710(gene)
ATGAAGAACAATAATAGATCTAAATCTCCTATTAATGGAGGAGGAAGTACTTATTCGTAA
GGAAGTGTACATAAAAAATCATAGCAATAACAATCATCTGTATAATAGTAATAGGACTCA
TCTTATTCAATATAAATTTCTGTGCGTATGAGACCTCTGCTTTAGGATTTTGAAGATGAA
GTCTCTTGGATAGTTGATAAATAAAATAAAAGTATACAAAGCCAAACCCAAAAGAACTTA
GCTTAGTCGATGAATGGAAATTCTAATTTATTAGCAGAATCTACTTCACTAACTCCAACA
AATGGTTAGTAGGGAAAAGGAAAATTAATGACAATGTCAACAATGAGCTAAGATTAACTT
GCCATAATGAGGAGGAGATATGCAGATGCGTATTACAATTACTCTTTTAACTTTGGTAAT
ACTTATTGAATTAGATGAATAAAAAGCATATTTAAATTGTATTTTAAATAACTTTCAATA
AAGATCAAGTATTTAGTCCTTAAGAAAGCACAGAATCTATATACAATTCAAGCTGCAAAA
ATATTGTTTACAGTGTTTTAGATGGATACAACAGTACAATCTTTATGTATGGCTAGACAA
CATCAGGTAAAACTTTTACGATGCTAGGAGATATGGACAATCCAGGTGTGCTTCCTTACT
CTCTTCATGATATTTTTGATGAAATAGAAAAGGTTTAGACTATTTTTTGTTTGTTTTGAT
CTAAGTTAATCAATTTTATTATTATTTTAAAGAGAAAAAAGGAGCAGGAGGTTGAATATC
AAGTGCTAGTTAGCTATATAGAAATTTACAATGAGTAGGTAAAGTTAAATTGATATGAAT
GTATAAATAAATCACAACTTATTTTTATGCTAAATAATATTTTAGATTAACGATCTTATA
AATCCTGGAATGACCAACTTAAGAATTCATGATGACCCAAAAGTAATAAAAATAGTTGAT
TGCAAAGAGAATTATTTCAACGATTAATTATCTTTTCAAATTTGAATATATCCTTCCTTT
TATTTAAAATAAACAGATTGGACCTATTGTTTAAGGAATGAAGCAATGTGAAGTTACTAA
TTTTAATGAAGCTATTATTTTAATGAGGTTTGGAGAAGAGCATCGTTGTTACAAGGAAAA
GAATATACATGAACACTCTTCCAGATCCCACACAATATTTTAGTTAAAAGTCCTTTCTAA
GAGTAAAAAAGAAAATAACTAATATTCCACCAAAGCAGCTGTTTTAGTAAATTAATTTGA
TTAAAATCTCAAAATCAAAATATATTTTTTAATAGAATCTAGTGGATCTTGCTGGTTCAG
AAAGGCTTCATGAAGAAGACTCTAAAAGTGGTAACAATGAAGAAACAGGTTTCATAAATA
AAAGTCTATTTGTGCTTTCTAATGTCATAAACAAGCTTGCTGAAGGAAAATCAAAGTAAA
AACTCATTGAATATTTCTCTTAATGCTTAACTTTTTATCATTTGAATTATACAAAATTAT
TTTTAAAATTAAATTTTTATGCTATGTAATAAAAAAATTAATAAGCTTCGTTTATAAAAT
AACTTTTATAAATTAAGATAATTATTCTTAAATTTAATGAGATAATTATTCATAAATTTA
ACGAGCTTTAATTTAAGTTAATTGATAAAAATGTTAAAAATATAATTAAGAATATTTGTT
TTATAAACGTAAATAGTAAATACATTCCTTTTAGAGATTCGAAACTAACTAGATTCCTTT
CAAATGCGCTTGGTGGCAATTCTATGACAGCTATTATTTGCACTATTTCTCCAGCTGCTA
TGAATTTCTATCAAACACTAAGTACCTTGAGATTTGCTACGAGGGCAAAAAAGGTTTACA
CTACTCCTGTTGTTAATGAAATTAAACATCCAAGAGATATTGGTGAGATTAATAAAGAGA
TTGATGAACTTAATTAACGTCTTATAGCTAAGAATACTGAAATAGAAATGATGTAGAAAG
ATAAGATTTTCTTAGAAAACACTTTAGTGGAGTCAACAAAATAAATTAATTTACTAAATA
AGGAAATTAAAAAAATAAAATCTAAATAAAATTTGGAAGATGATTATTCGCTGCAATACT
AGCAGCTATTAAATGATAATAATTTTATTGATATTTTAGCATAAAGAGTGGAATTATTTT
TGTGGGATGATTACAATTTAAGCACTAATAATTCGAGAGATGAAGACTATTCAGACTTAG
AAGATGAGAAAATGAAGAAAAAAAACAAATAAATAGATGAAGACGACAGAAATATCGGTT
CTAAATTGAAGGACAATATTAAAGAGAATTTCGAGTAATGTCATGCTGAGTGGAGCAAAA
TGCAATAAAAACTTGTAAATCGTTATAAATAAGATGTTTAAAATTTATAGATGAAGTACA
AAGACGAAATAAAAAATATGAGCAGATTTTACATGAAAGAAACAAAGTAAAACGAAAAAG
AACTCGAGGATATTATTTAAAACAGAGACGAACTTAAAATGATAAAAACTTTAGAAAAGC
AGATTGAAAAAAAAATAGATAACAATACTATTTTCAATGGAATAGCTGTTAATATAATTT
TAGATCCTCAACTGCCTATTGAGTTAGATACAGCTGAGGAAATAGAGTAATATGCAGTCA
ATGTAAAAGCTGCCTATTAAGAAGCTTCTTAATCATTGGAATAAAAGTTTAAAGACTATA
AATCTCTCCTTTCTAACATTTGCAAGACACAGATAAAATACTTCGCTTAATCAAGTAGCA
ATCATAATCATTTAAATAATAAAAATTATGTAAATGATAATAATAAGCTATCGTCAAGTA
TATAAAAGTTAACTTCTAGACATTCTGAAATGCTTCAAAAATTGACAGTTCTTTTTTCAA
ATAAATCATCCATACTCGAATCTGTTTATATTCAGGTTTGTTAAAATTTAGATATTAATC
CAGGATAGATTTTCTTACCAACAACGAGATCAGCTACAAGCACATCATAGTAATTTATAA
ATATTATTTACAATTATAATTAAGCATTTAAATTAATAGGTTTTCTAATATTACTGATAA
TAGGGTTCCATTTGCAGACTAAAGTTCAGTAGCAAATATCTTAAAATAAAATTACTCAAA
GTACCCTCCATCCTACGCAGTCAATAGCATTTAAGGAGATAAGTAAATAATAAATAACAC
TCCAAAATTTGAAGAATTTCTTTCCAACAAAAGACAAATCACAAATAAACAAATCACAGG
TATTAATTAATTGTTTAAATTAAACAATTTTTAAAAGCTAAATTAATTAGCCTATTTAAT
TACAAAAATAATTTTCAAAAACTCTCTCAAAAAATAATCTTTAAATTATGTAAAAAGTGG
AGGCATAAAATTTGACTATTTATTGAATTGTTTCTAAAATAAATATCTAAAAAAAATAAA
TAATATTTTAAAATAAAATTAGATTTTCTTGATTTAGAGGAGTTCTCTTCAATTTCTGAG
AGAGAAAATCATTAGGTTCATTAAAAGAATGGTTCAATGGAATATAACAGATCATATTAA
CATTAAAATTAATCTTCTATCCTCTAAAAAAAATAATAGAGTACTTTCGATTAGCTAAAA
TCAAAACCTGATGGTTCTATTATTACTTTTGCATGGGGTTCTGGCAAGGATGGAAGATTG
GGATTAGGTACTGATAGAGGAGAAAGCAATCCAACGATGCTAAATAGCCAATAATTCATA
TATTTATCTTGTGGTTATTATCACACTGCAGGAATAACTGAAAAAGGTATTTATAATTAA
TACTATTTACAAACTGATAAAGTTAAAAATATTTTATATTTCATTTAAACAGGAGAATTA
TATCTTTGGGGAAAAGGTAATAGTGGTTAACTAGGTAATTCTAGTTTTAATAGCTCAAAA
GTTCCTATCTTAGCGAACATCCCACAAACTATACCCATAGTATAGGTAGTATGTGGATGG
TAGCATAGCATGGCTTTATCTTCAAGTGGATAAGTTTATTCTTGGGTAAGATAGTTTATG
TGTATGTATTAAGTTATTTAATTGTATTTTATTATTTTAAATAGGGATTAGGAGAAGAAG
GATAATTAGGGCATAATGACATGGAAACCCTTAATACTCCTAAAATGATAGAATATTTTT
CTTAATAGGCCAAACAAATTAAATATATTTCCTGTGGGCATTCTCATTCTGCCGCCATTT
CAGGTTAAATATTGAATTTAAAAAAAGTTATTTACAATTTAACTTATCAAAAATAGAAGA
AGGAGATTTATACACTTGGGGTTGCAACTATGACTATAGACTAATGATAAATGAAAATAA
AAATTAATATAAGTAATATATTTTTTAATATATTTTAGATTACATAAATGTATATTAATT
AATAGGCCTGTTCTCACATAGTTACATTATCTCAAGGAGATTTACTAAAAAAGTGGATAA
GATATTTCTTAAAAGTTTAATGTTTAATTAGTTTCATTAGGAGTTAACCACACAGCTGTT
ATAACAGGTAGCAAAAAATAAATAATATATGATATTAAATATTATAATTATTTTATATAT
ACAGTTGATGGTAGTGTCTATACTGCTGGTTTAGGTAATCATGGAGAACTTGGAATCATT
TTGAATGAATCAGTTCCTAACACAGATATAATAAGAGATATAGTATGTTAACAAAATAGT
AATAATGTAGAAGAGCGATGCTGTTATTTACATAAAGTTTAAACTTTTGGCGAGGAAAAT
AAAGCAATAGATATCGCATGTGGCTATGAATTCACTATTGTATTAAATGCAGAAGGGACA
GTTTACTAATTTGGTAAAAAAATTTCTCAAGGACCTGATTTTATAGGAACTAAGCAGGAA
ATTCAAGATTATGTAACAAAAGATTCATAAAATGTCACTCCTTAAGTATTTCTTTTAATT
GATTAAGTTATTAATATAAACTAAAACATTTTTTTTGTTAGATTATGTATGAGTTTGGAA
ATATCCGAGTACAACAAATTGCTGCTGGAAAAAACCACATTGCAATAATAACTGGTATTT
TTTTATAATTTAAATAATTTTTTATTGTTATATTTAAAGATTTTTTATTACAATTTATTA
ATTCAAATTACAATAAAAGAGAATTGATTAAATTTTATTAATTATAGAAAATGGAGAATT
GTATACTTGGGGGAAAAATTTCTATGATAAACTAGATATGGGGGACGATAAACATGAAAG
CAAGTAACTAATTTTTAATTATTATCAAATATTTTCATCAACTATTTGTCTTACATATAT
AATAGCAAACCTGTTAAATTATTTGAAGGAATTAATAACTTGCAATGTATTTAAGTATCT
TGTGGTGAATTTCATTCTGTTTGCTTAAATAAGTGTTAAAAAAAGTGA