Identifiers and Description

Gene Model Identifier

TTHERM_00856650

Standard Name

KOT3 (Fusion of a ser/thr kinase and an O-linked N-acetylglucosamine transferase)

Aliases

PreTt12290 | 151.m00103

Description

Fusion of a ser/thr kinase and an O-linked N-acetylglucosamine transferase. TPR Domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01535 ) PPR repeat
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR02795 ) tol-pal system protein YbgF
  • ( TIGR00756 ) pentatricopeptide repeat domain
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR03302 ) outer membrane assembly lipoprotein YfiO
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR00990 ) mitochondrial precursor proteins import receptor
  • ( TIGR02917 ) putative PEP-CTERM system TPR-repeat lipoprotein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00856650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10118.12.000851114308011e-136hypothetical protein (1117 aa)
OxytrichaContig19078.0.g266.001502944943701e-53TPR repeat
WormBaseWBGene000038581.999534248571833e-46locus:ogt-1 status:Confirmed
UniProt:Q2L6Y4 protein_id
:CCD61615.1
Stentor CoeruleusSteCoe_12324.359610000063081e-28
DictyBaseDDB_G02778416.001696815660978e-24ctr9 on chromosome: 3 position
746082 to 749671
SGDYBR112C1.9999391735788327e-19CYC8 General transcriptional c
o-repressor, acts together wit
h Tup1p; also acts as part of
a transcriptional co-activator
complex that recruits the SWI
/SNF and SAGA complexes to pro
moters; can form the prion [OC
T+]

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00856650(coding)
ATGCATCAATACTAGTAGCAATAGGATTTAGATTTATAAAAGGTAAAATAAGAACTTGAG
GACCAAAAACAATTGAGGCTCCTTAGCTAGGGAAAAGGAACGTTGGGATAAATTTTTATA
GCAGAGCATATAATTTAGAAATCTTACCATGCAGTTAAAATCTTCTCACTTTAGGATGAG
AAGAATTAGATTTCTGCAAAAAAACTAGATAATGCTAAAAGAGAAGCAGAATTGCTGAAG
AATGTTAATCATCCCAATATAATCAGGTATGTCGATGAATTTTAAATCAACTTGAATTAC
TTTATCGTAACTGAGAAATGTGTAAAAAACTTAGAATAATTTATTTAAGAGTTTTAGAGC
CAATTGGCCTCAATTTCTAGACATCAGCTTGTTAATTTTGCTTGTTAAATACTGTCTGCA
ATTAATTACCTCCACCAAAAAAACTACATTATGAGAGAGCTCTCAATAAGGAGCATTTTG
ATAGATAGCGTTAACCAAATCAAACTCTGTGATTTTGGTCAAGCAAAATAAGTTCAAGAA
GAAATCAGCTATTCTCTGATTTTAAGAAATATACCTAAATCTGTCATTTTTTATTACCCA
CCTGAGCTTGTTAAATAAGTAGAAGCAAACGTAGAATAAAACAAAAAAGAATTTATGTTG
TATTTTAACAAAGATATTTGGGCATTTGGGATATGGCTTTATCTTTTAGCAGGAGCTACT
TAAAAAAATTGCTATAAACTTATGAAAAAAGGTTATTAAGCTTTGCAATGTTTAGATTAG
TCTTTAAGTTAAATTCTCTCTCAAACTCTTTCTTTAGATCCATTTAAAAGACCAAGCATT
TTAAAACTTGTTGATTTTTTCTAAAGCTTTAGGAAATAATTATGGAATTCTGAGTAAGCA
AAAATAGTTTATTGTTAATTTAAGAAAATGAGAAAACAAAATTAATTATATTTAGCATAT
TAGCTTATATCAATTTGTTTTTAAATGTAGCCAAAAAATGAAAAATATTCATTTTAATTA
GCTAATGTTTAAGACCAGCTAAAGTATTAGGAAGCAATAAATTAATATTTGAAATGCATT
GAGCTGAACCCAAAAGAGGATAGTTATTTATTGTTTCTTGGAATTGCTTAAAGGAATTAA
GGCATGTTTGATGAAGCAATAAAATCATTTAAGGAGTGTTTAAACTTGAATCCTAATTAT
GATGTGTGCTATTTTAACTTAGGAATTGTTTATAAGATCAAAAGAATTTATGATGAGGCC
ATTAAATAGTTTTAAAAATGTCTAAGGCTAAATCGTAAATATGACGCTTGCTTATTTAAT
TTGGGAATATCATATAAGAAGAAAGGTATGCTGAATAAGGCTATCAAATAATATAAGAAG
TGTCTGAGTTTAAATCCTAAATACGATGCTTGTCATTATAATTTAGGGATTGCTTATAAG
AAGAAAGGCATGGTGGATGAAGCACTTAAGTCATTTTAGGATTGTATTGATTTAAATCCT
AAATATGGCGCTTGCTATTATAACATAGGAAATATCTATTTGATGAAAGACTTGCTTGAG
GAAGCAATTGCTTAGTATTAAAAATGCTTAACTTTAGATCCAAATTATGAAGCTTGCTTT
TTTAATTTAGGTGTTATTTATAAGAAGAAATGTATGATAGAAGAAGCTGTTAACTTATTT
GAGAAATGTCTAAGTTTAAATTAAAAATATTATGCTTGCTATTATAACTTAGGACTCATT
TAAAATGAGAAAGGAATTATTGATGAAGCAATTAAATTGTTCTTAAAATGTCTTGATATT
AATCCAAATTTTGATGCTTGCTATTATAGTCTTGGAGTAGCTTATAAAAATAAAGGCATG
CTAAATGATGCCATAAAATAATTTTAAAATTGCATAAATCTCAATTCTAAATTAGATTAT
TGCTTTTTCGAATTAGGAAATGTTTAATACGATTAGGGCATGCTGGATGAATCTGTTTAA
TCTTATTTGAAATGTATTGATCTAAATTAAAGTTTCTAAAATTGTTCTTTGAAATTAGGA
AATATTTATCAGTAAAAAGGGATGCTAGATGAGGCAATTAAATAATTTTAGAAGTATCTT
AGTATTGATTCAGAAAATGATACTTGTCAAATGAATTTAGGTATTTGTTTAGAAAAAACA
GGAAAGCTGGATGAAGCTATAAAATAGTTTTAAAATTGTCTTGATTTAAATCCAAAAAAT
GAAATTTGTTATTTAAAGATTGGCGATGTCTACAGGAAGAAAGCAATGATTAATGAAGCT
ATTAGCGCATATAAAAAATGCTTAGAAATAAATCCAAAGAATGACATTTGTTGCTTAAGC
TTAGGCATTTGCTTGGAGAATTCAAATAAAATAAATGAAGCCATCGAATGCTATTTAAAT
TGTATTGAAATTAATCCTTAAAATGATATTTGTTACATGAATTTGGGAAATTTGTATTAA
AATTAAAATGAGCTTGATAAGGCTATTGAGTCATACTATAAATGTTTGAATGTAAACCCA
TAGTTAGATAGCTGCTATTATTATTTAGGAGAAGCTTAATATAAAAAATCTCTATTTGAT
GAATCAATAAAGTCATACTTAAAGTGCTTAGAAATTAATCCAAACAATGAAGCTTGTTAC
TTAAGTTTAGGTTAGACTTATCAGAATTAAGGCATGATAAATGAGGCAATCTTAATTTAT
GAAAAATCACTAAACCTAAATATAAAGATTGATGTTTGTTGCTTGAATTTAGGAGTTTGC
TATGAAATAAAAGGAAGAATTGATGAAGCAATAAAAAAATATTAATAATCAATTGAAATA
AACCCAGCAAATGATGTTTGTTTTTTGAACTTAGGAAACGCTTATTTGAATAAAGGAATG
TTTGACGAAGCAATCTAAGCATATTAAAAATGCTTGCAGCTAAACCCGAAAAAAGAAGCT
TGCTATTTAAATCTTGGCAATGTGTATTAAATTAAAGGGGAACTAGATAAGGCTATTAAA
TGTTATCAGAAATGCATAATTTTAAATCCAAAAAAAGATATTTGCTATTTGAATTTAGGT
AATGCATATTAAAATAAAGGTAATTTAGAAGAGTCCATTAAAAATTATCAGAAATGTCTA
AATCTTAATCCAAAAAATGACACTTGTTTGGAAAACTTGGGAAACGCTTTTAAAAATAAA
GGAATGATAGAAGAAGCCATCAAATAATATCGATTTTGTCTATAATTAAATCCAAATAAG
TATTCTTGCTATTTGAATTTGGGTAATACTTACTAGAAAAAAGGAATGCTAGATGAAGCT
ATTGAATGCTATAACAAATGTATAAATATCAATCCTAATAATGAAACGAGTTACGCCAAT
TTAGGGCTCTGCTATTTAAGCAAAGATATGAAGTATGATGCCATTAAACAATTCTAAAAA
TGTCTTCAAATTAACCCAAATAATAAAACTTGTCTAATTAGTCTATAAAAAATGCAAAAT
AAAAAAAATTGA


>TTHERM_00856650(protein)
MHQYQQQQDLDLQKVKQELEDQKQLRLLSQGKGTLGQIFIAEHIIQKSYHAVKIFSLQDE
KNQISAKKLDNAKREAELLKNVNHPNIIRYVDEFQINLNYFIVTEKCVKNLEQFIQEFQS
QLASISRHQLVNFACQILSAINYLHQKNYIMRELSIRSILIDSVNQIKLCDFGQAKQVQE
EISYSLILRNIPKSVIFYYPPELVKQVEANVEQNKKEFMLYFNKDIWAFGIWLYLLAGAT
QKNCYKLMKKGYQALQCLDQSLSQILSQTLSLDPFKRPSILKLVDFFQSFRKQLWNSEQA
KIVYCQFKKMRKQNQLYLAYQLISICFQMQPKNEKYSFQLANVQDQLKYQEAINQYLKCI
ELNPKEDSYLLFLGIAQRNQGMFDEAIKSFKECLNLNPNYDVCYFNLGIVYKIKRIYDEA
IKQFQKCLRLNRKYDACLFNLGISYKKKGMLNKAIKQYKKCLSLNPKYDACHYNLGIAYK
KKGMVDEALKSFQDCIDLNPKYGACYYNIGNIYLMKDLLEEAIAQYQKCLTLDPNYEACF
FNLGVIYKKKCMIEEAVNLFEKCLSLNQKYYACYYNLGLIQNEKGIIDEAIKLFLKCLDI
NPNFDACYYSLGVAYKNKGMLNDAIKQFQNCINLNSKLDYCFFELGNVQYDQGMLDESVQ
SYLKCIDLNQSFQNCSLKLGNIYQQKGMLDEAIKQFQKYLSIDSENDTCQMNLGICLEKT
GKLDEAIKQFQNCLDLNPKNEICYLKIGDVYRKKAMINEAISAYKKCLEINPKNDICCLS
LGICLENSNKINEAIECYLNCIEINPQNDICYMNLGNLYQNQNELDKAIESYYKCLNVNP
QLDSCYYYLGEAQYKKSLFDESIKSYLKCLEINPNNEACYLSLGQTYQNQGMINEAILIY
EKSLNLNIKIDVCCLNLGVCYEIKGRIDEAIKKYQQSIEINPANDVCFLNLGNAYLNKGM
FDEAIQAYQKCLQLNPKKEACYLNLGNVYQIKGELDKAIKCYQKCIILNPKKDICYLNLG
NAYQNKGNLEESIKNYQKCLNLNPKNDTCLENLGNAFKNKGMIEEAIKQYRFCLQLNPNK
YSCYLNLGNTYQKKGMLDEAIECYNKCININPNNETSYANLGLCYLSKDMKYDAIKQFQK
CLQINPNNKTCLISLQKMQNKKN


>TTHERM_00856650(gene)
ATGCATCAATACTAGTAGCAATAGGATTTAGATTTATAAAAGGTAAAATAAGAACTTGAG
GACCAAAAACAATTGAGGCTCCTTAGCTAGGGAAAAGGAACGTTGGGATAAATTTTTATA
GCAGAGCATATAATTTAGAAATCTTACCATGCAGTTAAAATCTTCTCACTTTAGGATGAG
AAGAATTAGATTTCTGCAAAAAAACTAGATAATGCTAAAAGAGAAGCAGAATTGCTGAAG
AATGTTAATCATCCCAATATAATCAGGTATGTCGATGAATTTTAAATCAACTTGAATTAC
TTTATCGTAACTGAGAAATGTGTAAAAAACTTAGAATAATTTATTTAAGAGTTTTAGAGC
CAATTGGCCTCAATTTCTAGACATCAGCTTGTTAATTTTGCTTGTTAAATACTGTCTGCA
ATTAATTACCTCCACCAAAAAAACTACATTATGAGAGAGCTCTCAATAAGGAGCATTTTG
ATAGATAGCGTTAACCAAATCAAACTCTGTGATTTTGGTCAAGCAAAATAAGTTCAAGAA
GAAATCAGCTATTCTCTGATTTTAAGAAATATACCTAAATCTGTCATTTTTTATTACCCA
CCTGAGCTTGTTAAATAAGTAGAAGCAAACGTAGAATAAAACAAAAAAGAATTTATGTTG
TATTTTAACAAAGATATTTGGGCATTTGGGATATGGCTTTATCTTTTAGCAGGAGCTACT
TAAAAAAATTGCTATAAACTTATGAAAAAAGGTTATTAAGCTTTGCAATGTTTAGATTAG
TCTTTAAGTTAAATTCTCTCTCAAACTCTTTCTTTAGATCCATTTAAAAGACCAAGCATT
TTAAAACTTGTTGATTTTTTCTAAAGCTTTAGGAAATAATTATGGAATTCTGAGTAAGCA
AAAATAGTTTATTGTTAATTTAAGAAAATGAGAAAACAAAATTAATTATATTTAGCATAT
TAGCTTATATCAATTTGTTTTTAAATGTAGCCAAAAAATGAAAAATATTCATTTTAATTA
GCTAATGTTTAAGACCAGCTAAAGTATTAGGAAGCAATAAATTAATATTTGAAATGCATT
GAGCTGAACCCAAAAGAGGATAGTTATTTATTGTTTCTTGGAATTGCTTAAAGGAATTAA
GGCATGTTTGATGAAGCAATAAAATCATTTAAGGAGTGTTTAAACTTGAATCCTAATTAT
GATGTGTGCTATTTTAACTTAGGAATTGTTTATAAGATCAAAAGAATTTATGATGAGGCC
ATTAAATAGTTTTAAAAATGTCTAAGGCTAAATCGTAAATATGACGCTTGCTTATTTAAT
TTGGGAATATCATATAAGAAGAAAGGTATGCTGAATAAGGCTATCAAATAATATAAGAAG
TGTCTGAGTTTAAATCCTAAATACGATGCTTGTCATTATAATTTAGGGATTGCTTATAAG
AAGAAAGGCATGGTGGATGAAGCACTTAAGTCATTTTAGGATTGTATTGATTTAAATCCT
AAATATGGCGCTTGCTATTATAACATAGGAAATATCTATTTGATGAAAGACTTGCTTGAG
GAAGCAATTGCTTAGTATTAAAAATGCTTAACTTTAGATCCAAATTATGAAGCTTGCTTT
TTTAATTTAGGTGTTATTTATAAGAAGAAATGTATGATAGAAGAAGCTGTTAACTTATTT
GAGAAATGTCTAAGTTTAAATTAAAAATATTATGCTTGCTATTATAACTTAGGACTCATT
TAAAATGAGAAAGGAATTATTGATGAAGCAATTAAATTGTTCTTAAAATGTCTTGATATT
AATCCAAATTTTGATGCTTGCTATTATAGTCTTGGAGTAGCTTATAAAAATAAAGGCATG
CTAAATGATGCCATAAAATAATTTTAAAATTGCATAAATCTCAATTCTAAATTAGATTAT
TGCTTTTTCGAATTAGGAAATGTTTAATACGATTAGGGCATGCTGGATGAATCTGTTTAA
TCTTATTTGAAATGTATTGATCTAAATTAAAGTTTCTAAAATTGTTCTTTGAAATTAGGA
AATATTTATCAGTAAAAAGGGATGCTAGATGAGGCAATTAAATAATTTTAGAAGTATCTT
AGTATTGATTCAGAAAATGATACTTGTCAAATGAATTTAGGTATTTGTTTAGAAAAAACA
GGAAAGCTGGATGAAGCTATAAAATAGTTTTAAAATTGTCTTGATTTAAATCCAAAAAAT
GAAATTTGTTATTTAAAGATTGGCGATGTCTACAGGAAGAAAGCAATGATTAATGAAGCT
ATTAGCGCATATAAAAAATGCTTAGAAATAAATCCAAAGAATGACATTTGTTGCTTAAGC
TTAGGCATTTGCTTGGAGAATTCAAATAAAATAAATGAAGCCATCGAATGCTATTTAAAT
TGTATTGAAATTAATCCTTAAAATGATATTTGTTACATGAATTTGGGAAATTTGTATTAA
AATTAAAATGAGCTTGATAAGGCTATTGAGTCATACTATAAATGTTTGAATGTAAACCCA
TAGTTAGATAGCTGCTATTATTATTTAGGAGAAGCTTAATATAAAAAATCTCTATTTGAT
GAATCAATAAAGTCATACTTAAAGTGCTTAGAAATTAATCCAAACAATGAAGCTTGTTAC
TTAAGTTTAGGTTAGACTTATCAGAATTAAGGCATGATAAATGAGGCAATCTTAATTTAT
GAAAAATCACTAAACCTAAATATAAAGATTGATGTTTGTTGCTTGAATTTAGGAGTTTGC
TATGAAATAAAAGGAAGAATTGATGAAGCAATAAAAAAATATTAATAATCAATTGAAATA
AACCCAGCAAATGATGTTTGTTTTTTGAACTTAGGAAACGCTTATTTGAATAAAGGAATG
TTTGACGAAGCAATCTAAGCATATTAAAAATGCTTGCAGCTAAACCCGAAAAAAGAAGCT
TGCTATTTAAATCTTGGCAATGTGTATTAAATTAAAGGGGAACTAGATAAGGCTATTAAA
TGTTATCAGAAATGCATAATTTTAAATCCAAAAAAAGATATTTGCTATTTGAATTTAGGT
AATGCATATTAAAATAAAGGTAATTTAGAAGAGTCCATTAAAAATTATCAGAAATGTCTA
AATCTTAATCCAAAAAATGACACTTGTTTGGAAAACTTGGGAAACGCTTTTAAAAATAAA
GGAATGATAGAAGAAGCCATCAAATAATATCGATTTTGTCTATAATTAAATCCAAATAAG
TATTCTTGCTATTTGAATTTGGGTAATACTTACTAGAAAAAAGGAATGCTAGATGAAGCT
ATTGAATGCTATAACAAATGTATAAATATCAATCCTAATAATGAAACGAGTTACGCCAAT
TTAGGGCTCTGCTATTTAAGCAAAGATATGAAGTATGATGCCATTAAACAATTCTAAAAA
TGTCTTCAAATTAACCCAAATAATAAAACTTGTCTAATTAGTCTATAAAAAATGCAAAAT
AAAAAAAATTGA