Identifiers and Description

Gene Model Identifier

TTHERM_00678530

Standard Name

KOT2 (Fusion of a ser/thr kinase and an O-linked N-acetylglucosamine transferase)

Aliases

PreTt07617 | 102.m00137 | 3730.m00064

Description

Fusion of a ser/thr kinase and an O-linked N-acetylglucosamine transferase. TPR Domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08238 ) Sel1 repeat
  • ( PF00069 ) protein kinase domain
  • ( PF02184 ) HAT (Half-A-TPR) repeat
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( PF09034 ) TRADD, N-terminal domain
  • ( TIGR02795 ) tol-pal system protein YbgF
  • ( TIGR03302 ) outer membrane assembly lipoprotein YfiO
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR00990 ) mitochondrial precursor proteins import receptor
  • ( TIGR02917 ) putative PEP-CTERM system TPR-repeat lipoprotein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00678530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00257.13.0005817332825333e-174hypothetical protein (1317 aa)
OxytrichaContig19078.0.g265.001425520048966e-32TPR repeat
WormBaseWBGene000038583.9992896861436003e-19locus:ogt-1 status:Confirmed
UniProt:Q2L6Y4 protein_id
:CCD61615.1
DictyBaseDDB_G02745032.0004286606204839e-16plk on chromosome: 2 position
4379150 to 4382891
SGDYJL095W7.003160085026828e-16BCK1 Mitogen-activated protein
(MAP) kinase kinase kinase ac
ting in the protein kinase C s
ignaling pathway, which contro
ls cell integrity; upon activa
tion by Pkc1p phosphorylates d
ownstream kinases Mkk1p and Mk
k2p
Stentor CoeruleusSteCoe_12320.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00678530(coding)
ATGAATTCAAGTTAAACTGAAGAGGAAGCCATTTTACAAGAAACTTTAGAGTTTCTTCAA
GAAGAATTAGAGCAAAATAAGGGCTTTAAAATCACTAACAAATATGGTGGTAGAGGTGGA
TTTGGTTTGGTCTTATTTGTAGAAGAAATGTCTGATCCATCTAAAAAATATGCTATTAAA
GCTTAATCTATTATTAATACTATGACAGGAAAGGTTAATAAGAATCTTCTTAAATAATGC
GAGGATGAAGCTACAATTTTGCGATCCTGCGATCACAAAAATATAGTTTAAATCCATTCA
GACTTCGTAATTGGACTTTATCACTTTATTTAAATGAATTTATGTTAGTGTTCACTTTAA
GATTGGATTGATTAAAATACACAGCCTATAAATGATATGCTGTTTCTCCATTATGTTAAT
TAAATTATTGACGGAATTGAGTATTTGCATAATAAGGATTATGTTCTAAGAGATCTTTCA
GTAAGAAATATTCTTATAACAACTGATAACATTGTTAAGCTTTGTGATTTTGGGCTTGCT
AAAAAGTATGATGATCTATTAAAAAGCAAAGTTCTATATACTTAAACAGCTAGAGGTGTT
TTTTTGTATTTCCCACCTGAATTACAAGAAGATTTAAATGCACAAAAGTCTTAAATTAAA
TAAACAAAAAAAGGTGATATTTGGGCTTTTGGTATCTGTCTAATGATACTTGGGGGCATA
AAATATAACTAGCTATTAAATTTGTAAAACAATAATTATCAAGTATCTGATGCTCCTTTT
TTATCTGAGAGCTCAAATTAATTAATAAAATTCATACTAAATAAAGATCCTCAAAAAAGA
CCTTCTTTTCCTGAAATTAGAGAAAAAATATTTTCTTTGTATTATGGAAGAAATGGTATG
TTAAATGAAAGTTTGGGTTCAAAGAGTACACAAAGCTCTTCTGGTTCAGAACTAATTGAT
GTTTTATAGTCAAGTAAATTGAAGTTTTATTCTGAGAGCTAAACCATTCTAACATAAATT
ACGGAAGCGAATCAAGTACTATAATCTCCTATAAATTAAGAAACAAATAGGAAGTTATCA
TCAAGTTTAGAATAGTTCCCTATAAGTAATAAAAAGGATGATTCAGAGAAAATACCTGAA
GTATAATTGCATAAGAAGGCTTTTAGTGTGTAGGTTGCAATAGATAAAAATATTGATATA
GATTTTATGGAAACAAATATTATTTTTAACAAGTACTCAAAACATTTGAAAGAATATCCT
AATAGTGTGCAAGCGCTATTAACTCTTGGCTATTTAAATGCATACGCTTTTTCCAATTAT
GAATTATCAAAAAAGTATTTCGAAGAAGCAATATAAATTGATGGCAATGAAATTGATGCA
TATTTAGGTATCTGCACATGCATTATTTTGAACAGAGAGCTCAAATATATTTCAAAAGCA
AAATCATATTTAAATAAGTGTCTCTCAATAAAGAAATAGTATTGGAGGACATACTATATT
TATGCTTGGTTACTCATATTAGCTAATAAAGAAAAGGAAGCTCTCAATTATTTGATTTAA
GGCCTTTAAATTGAAAATTAATCAGTTGAGTTGTTATCACTTTAGCTTATATAATATAGA
CATTAAAATTAAATCAATACTTTAGATCTCGCAGAAAAAGTTGCTAATTTAAATAAGAAA
CATAATCCAGTCGTATTTTAAAGATTAGGTAGTTTCTACAGCAATGAAATGCAAAACTAT
ACAAAAGCTATATACTTTTACAAGTAAGCTTATGAAATTAACAAAAAAGACCTATTAACT
CACATTCATTTAGCTGATAATTATTATAAAAATAAAGATTCTTGGGAGGCCGAATAATAT
CTAATCAATGCTTAAATTCTTTATCCCGAAAATTCTATTTTATTAAATTTCCTTGGCCAA
AAAGAGGTTGATTTAGCAAATTAAGAGCAACTCTTTAAAAAATCTATTTCTTTAGATCCA
TATAATAAGTGGGCACTCTACAACCTAGCTAGGTGTTAATTAAGCCTAGGAAATTTTGAA
AGTGCAATTAAATATTATAAAAAGGTGTTAGAGTAAGATCCAGAAGATGAGCAAGCTAAT
GCAGGAATTGGTTTAGTATTAGGATTTTATTTACAAGATTTCAATTAGGCTATTGAGCAC
TATAAAATTGCTATTAATACTAATTTTTTAAAGTTAGAATATTTAATTAATTTAGCAAAT
TTACATCTAAATATAAAAGATTTAGATTCAGCTTAAAGTTATATAAATTAATGTATGTAG
ATCAATTCAAACACACCTAAAATTTATGAAATCCTCTGCAAAATAGAGTAATAGAAAGGA
AACTCTTTAAAAGCTGTGGAGTACATACAAAAATAAATGGAGCTCGAACCCTAAAATGCA
GATGTTTATCATAGATTAGGTCAGTTGTATCATCAAAGTAACCCTGAGGAAGCTAAAAAA
AATTATATTAAATCCCTTTAGCTTGATCCAAAATAAAAAATGGTAAATTATCGTCTAGGA
CTTTTAGAAAAGGAATTCACATAGCAGATAAAGTACTACCAAAATGAATTAATTATAAAC
CCACAAAACATAGAAGCAATCAGTGCTGTGGCTATGTCTTTATAATGCTAAGGAAAATAC
GACCTTGCTTTACAATTTTTATAAAAAGGATTAAAAAGAGATCCAAACAATTACATTTTG
TATAAAAATATTGCAAATGTTTATAGCATTCAAAGAAAATATTATGAATCAATAGAAAGC
TATAAATAAGCCCTTAATCTTAATGCATAAAATATAGAGTTACTTTTTCTATTAGCAAAT
ACTTATTTTCTATCTGGCTAAACAGAAAATGCAATTGATAATTATAAAGAAGCAATAAAG
TTAAATCCATCTTATCATCAATCTTATTTTGAGTTAGGAAAAATCTACGAAGAATTAAAA
CAATATTAATAGGCAGTTGAACAATTTTAAGTTTATCTTTAATATTAACCCAACTCCTCT
GAAACTTATTATAAAATTGGTATGATAGAGTATCTCCATTTTAAAAATATTTAAAAAGCA
TAGATCTGCTTCATTTAATCAATATAACTTAATCCTAACAACAACTCTTCATGCTACAGA
TATTTAGGATTAATTTAAAATGAATTAGGTGATTACAAGCAAGCCAAACAAAATTTTTTA
TAAGCTATTGAAATTAATAAAAACGAAGAAGATTTATACTTTATACTTGCATAGATTTCC
TACAATTACTTCAAAGATATATGGTAAGCTATTGAGTACTTAGAAAAATATCTGTAGCTA
TTCCCAAACTAAGAAAAATAAGAGTAATTACTAAACGAATGGTACCTAAAAGTAAATAAC
ACAGTGAGAGCAAGAGAAACCTATGAAAAACAGATTTAAGAAAACCCACAAAATATTAGT
GCAATCATGAAAATAGCTAGTATAGAGTACCAAGTTAAAAATTATCATAAATCAATTTTC
CAATATAACAAAGTTTTAGAAATAGATCCAAATAATAAACTCTCCCTTTATAATATCGGA
CTCTGCTTTAAATAGCTTGAAAAATATGAAAAAGCAGTAGAATATTTTTAAAATGTAATT
AAGATTTACTAAAGTTTTTCCCTTGCTTACTATTAAATTGGAGAAATAGAATAGAGGTAT
CTAAATAACCCAAAAAAGGCAATTAAATTTTTAAGAAAAGCAATCGAACTAAAAGGCTAA
GATGCAGATAGTTATTTTTACTTAGGACTTGCATTCGATAAAATTGACTACAAGTATGAA
GCTCTTGAGTGCTTTTAAAAATTATTAGATTGCAGTCCAAAATACCCAACAGCTGATTTC
TGTAAAAAATATATCTCCGAAAATATAATTGTCAAAAAAAAGAAATACAAAGAGACTACT
CTTGAAGAAAATGATTGCAAAGTTTTTTGA


>TTHERM_00678530(protein)
MNSSQTEEEAILQETLEFLQEELEQNKGFKITNKYGGRGGFGLVLFVEEMSDPSKKYAIK
AQSIINTMTGKVNKNLLKQCEDEATILRSCDHKNIVQIHSDFVIGLYHFIQMNLCQCSLQ
DWIDQNTQPINDMLFLHYVNQIIDGIEYLHNKDYVLRDLSVRNILITTDNIVKLCDFGLA
KKYDDLLKSKVLYTQTARGVFLYFPPELQEDLNAQKSQIKQTKKGDIWAFGICLMILGGI
KYNQLLNLQNNNYQVSDAPFLSESSNQLIKFILNKDPQKRPSFPEIREKIFSLYYGRNGM
LNESLGSKSTQSSSGSELIDVLQSSKLKFYSESQTILTQITEANQVLQSPINQETNRKLS
SSLEQFPISNKKDDSEKIPEVQLHKKAFSVQVAIDKNIDIDFMETNIIFNKYSKHLKEYP
NSVQALLTLGYLNAYAFSNYELSKKYFEEAIQIDGNEIDAYLGICTCIILNRELKYISKA
KSYLNKCLSIKKQYWRTYYIYAWLLILANKEKEALNYLIQGLQIENQSVELLSLQLIQYR
HQNQINTLDLAEKVANLNKKHNPVVFQRLGSFYSNEMQNYTKAIYFYKQAYEINKKDLLT
HIHLADNYYKNKDSWEAEQYLINAQILYPENSILLNFLGQKEVDLANQEQLFKKSISLDP
YNKWALYNLARCQLSLGNFESAIKYYKKVLEQDPEDEQANAGIGLVLGFYLQDFNQAIEH
YKIAINTNFLKLEYLINLANLHLNIKDLDSAQSYINQCMQINSNTPKIYEILCKIEQQKG
NSLKAVEYIQKQMELEPQNADVYHRLGQLYHQSNPEEAKKNYIKSLQLDPKQKMVNYRLG
LLEKEFTQQIKYYQNELIINPQNIEAISAVAMSLQCQGKYDLALQFLQKGLKRDPNNYIL
YKNIANVYSIQRKYYESIESYKQALNLNAQNIELLFLLANTYFLSGQTENAIDNYKEAIK
LNPSYHQSYFELGKIYEELKQYQQAVEQFQVYLQYQPNSSETYYKIGMIEYLHFKNIQKA
QICFIQSIQLNPNNNSSCYRYLGLIQNELGDYKQAKQNFLQAIEINKNEEDLYFILAQIS
YNYFKDIWQAIEYLEKYLQLFPNQEKQEQLLNEWYLKVNNTVRARETYEKQIQENPQNIS
AIMKIASIEYQVKNYHKSIFQYNKVLEIDPNNKLSLYNIGLCFKQLEKYEKAVEYFQNVI
KIYQSFSLAYYQIGEIEQRYLNNPKKAIKFLRKAIELKGQDADSYFYLGLAFDKIDYKYE
ALECFQKLLDCSPKYPTADFCKKYISENIIVKKKKYKETTLEENDCKVF


>TTHERM_00678530(gene)
ATGAATTCAAGTTAAACTGAAGAGGAAGCCATTTTACAAGAAACTTTAGAGTTTCTTCAA
GAAGAATTAGAGCAAAATAAGGGCTTTAAAATCACTAACAAATATGGTGGTAGAGGTGGA
TTTGGTTTGGTCTTATTTGTAGAAGAAATGTCTGATCCATCTAAAAAATATGCTATTAAA
GCTTAATCTATTATTAATACTATGACAGGAAAGGTTAATAAGAATCTTCTTAAATAATGC
GAGGATGAAGCTACAATTTTGCGATCCTGCGATCACAAAAATATAGTTTAAATCCATTCA
GACTTCGTAATTGGACTTTATCACTTTATTTAAATGAATTTATGTTAGTGTTCACTTTAA
GATTGGATTGATTAAAATACACAGCCTATAAATGATATGCTGTTTCTCCATTATGTTAAT
TAAATTATTGACGGAATTGAGTATTTGCATAATAAGGATTATGTTCTAAGAGATCTTTCA
GTAAGAAATATTCTTATAACAACTGATAACATTGTTAAGCTTTGTGATTTTGGGCTTGCT
AAAAAGTATGATGATCTATTAAAAAGCAAAGTTCTATATACTTAAACAGCTAGAGGTGTT
TTTTTGTATTTCCCACCTGAATTACAAGAAGATTTAAATGCACAAAAGTCTTAAATTAAA
TAAACAAAAAAAGGTGATATTTGGGCTTTTGGTATCTGTCTAATGATACTTGGGGGCATA
AAATATAACTAGCTATTAAATTTGTAAAACAATAATTATCAAGTATCTGATGCTCCTTTT
TTATCTGAGAGCTCAAATTAATTAATAAAATTCATACTAAATAAAGATCCTCAAAAAAGA
CCTTCTTTTCCTGAAATTAGAGAAAAAATATTTTCTTTGTATTATGGAAGAAATGGTATG
TTAAATGAAAGTTTGGGTTCAAAGAGTACACAAAGCTCTTCTGGTTCAGAACTAATTGAT
GTTTTATAGTCAAGTAAATTGAAGTTTTATTCTGAGAGCTAAACCATTCTAACATAAATT
ACGGAAGCGAATCAAGTACTATAATCTCCTATAAATTAAGAAACAAATAGGAAGTTATCA
TCAAGTTTAGAATAGTTCCCTATAAGTAATAAAAAGGATGATTCAGAGAAAATACCTGAA
GTATAATTGCATAAGAAGGCTTTTAGTGTGTAGGTTGCAATAGATAAAAATATTGATATA
GATTTTATGGAAACAAATATTATTTTTAACAAGTACTCAAAACATTTGAAAGAATATCCT
AATAGTGTGCAAGCGCTATTAACTCTTGGCTATTTAAATGCATACGCTTTTTCCAATTAT
GAATTATCAAAAAAGTATTTCGAAGAAGCAATATAAATTGATGGCAATGAAATTGATGCA
TATTTAGGTATCTGCACATGCATTATTTTGAACAGAGAGCTCAAATATATTTCAAAAGCA
AAATCATATTTAAATAAGTGTCTCTCAATAAAGAAATAGTATTGGAGGACATACTATATT
TATGCTTGGTTACTCATATTAGCTAATAAAGAAAAGGAAGCTCTCAATTATTTGATTTAA
GGCCTTTAAATTGAAAATTAATCAGTTGAGTTGTTATCACTTTAGCTTATATAATATAGA
CATTAAAATTAAATCAATACTTTAGATCTCGCAGAAAAAGTTGCTAATTTAAATAAGAAA
CATAATCCAGTCGTATTTTAAAGATTAGGTAGTTTCTACAGCAATGAAATGCAAAACTAT
ACAAAAGCTATATACTTTTACAAGTAAGCTTATGAAATTAACAAAAAAGACCTATTAACT
CACATTCATTTAGCTGATAATTATTATAAAAATAAAGATTCTTGGGAGGCCGAATAATAT
CTAATCAATGCTTAAATTCTTTATCCCGAAAATTCTATTTTATTAAATTTCCTTGGCCAA
AAAGAGGTTGATTTAGCAAATTAAGAGCAACTCTTTAAAAAATCTATTTCTTTAGATCCA
TATAATAAGTGGGCACTCTACAACCTAGCTAGGTGTTAATTAAGCCTAGGAAATTTTGAA
AGTGCAATTAAATATTATAAAAAGGTGTTAGAGTAAGATCCAGAAGATGAGCAAGCTAAT
GCAGGAATTGGTTTAGTATTAGGATTTTATTTACAAGATTTCAATTAGGCTATTGAGCAC
TATAAAATTGCTATTAATACTAATTTTTTAAAGTTAGAATATTTAATTAATTTAGCAAAT
TTACATCTAAATATAAAAGATTTAGATTCAGCTTAAAGTTATATAAATTAATGTATGTAG
ATCAATTCAAACACACCTAAAATTTATGAAATCCTCTGCAAAATAGAGTAATAGAAAGGA
AACTCTTTAAAAGCTGTGGAGTACATACAAAAATAAATGGAGCTCGAACCCTAAAATGCA
GATGTTTATCATAGATTAGGTCAGTTGTATCATCAAAGTAACCCTGAGGAAGCTAAAAAA
AATTATATTAAATCCCTTTAGCTTGATCCAAAATAAAAAATGGTAAATTATCGTCTAGGA
CTTTTAGAAAAGGAATTCACATAGCAGATAAAGTACTACCAAAATGAATTAATTATAAAC
CCACAAAACATAGAAGCAATCAGTGCTGTGGCTATGTCTTTATAATGCTAAGGAAAATAC
GACCTTGCTTTACAATTTTTATAAAAAGGATTAAAAAGAGATCCAAACAATTACATTTTG
TATAAAAATATTGCAAATGTTTATAGCATTCAAAGAAAATATTATGAATCAATAGAAAGC
TATAAATAAGCCCTTAATCTTAATGCATAAAATATAGAGTTACTTTTTCTATTAGCAAAT
ACTTATTTTCTATCTGGCTAAACAGAAAATGCAATTGATAATTATAAAGAAGCAATAAAG
TTAAATCCATCTTATCATCAATCTTATTTTGAGTTAGGAAAAATCTACGAAGAATTAAAA
CAATATTAATAGGCAGTTGAACAATTTTAAGTTTATCTTTAATATTAACCCAACTCCTCT
GAAACTTATTATAAAATTGGTATGATAGAGTATCTCCATTTTAAAAATATTTAAAAAGCA
TAGATCTGCTTCATTTAATCAATATAACTTAATCCTAACAACAACTCTTCATGCTACAGA
TATTTAGGATTAATTTAAAATGAATTAGGTGATTACAAGCAAGCCAAACAAAATTTTTTA
TAAGCTATTGAAATTAATAAAAACGAAGAAGATTTATACTTTATACTTGCATAGATTTCC
TACAATTACTTCAAAGATATATGGTAAGCTATTGAGTACTTAGAAAAATATCTGTAGCTA
TTCCCAAACTAAGAAAAATAAGAGTAATTACTAAACGAATGGTACCTAAAAGTAAATAAC
ACAGTGAGAGCAAGAGAAACCTATGAAAAACAGATTTAAGAAAACCCACAAAATATTAGT
GCAATCATGAAAATAGCTAGTATAGAGTACCAAGTTAAAAATTATCATAAATCAATTTTC
CAATATAACAAAGTTTTAGAAATAGATCCAAATAATAAACTCTCCCTTTATAATATCGGA
CTCTGCTTTAAATAGCTTGAAAAATATGAAAAAGCAGTAGAATATTTTTAAAATGTAATT
AAGATTTACTAAAGTTTTTCCCTTGCTTACTATTAAATTGGAGAAATAGAATAGAGGTAT
CTAAATAACCCAAAAAAGGCAATTAAATTTTTAAGAAAAGCAATCGAACTAAAAGGCTAA
GATGCAGATAGTTATTTTTACTTAGGACTTGCATTCGATAAAATTGACTACAAGTATGAA
GCTCTTGAGTGCTTTTAAAAATTATTAGATTGCAGTCCAAAATACCCAACAGCTGATTTC
TGTAAAAAATATATCTCCGAAAATATAATTGTCAAAAAAAAGAAATACAAAGAGACTACT
CTTGAAGAAAATGATTGCAAAGTTTTTTGA