Identifiers and Description

Gene Model Identifier

TTHERM_00257190

Standard Name

KOT1 (Fusion of a ser/thr kinase and an O-linked N-acetylglucosamine transferase)

Aliases

PreTt25405 | 22.m00350

Description

Fusion of a ser/thr kinase and an O-linked N-acetylglucosamine transferase. TPR Domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08238 ) Sel1 repeat
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR02795 ) tol-pal system protein YbgF
  • ( TIGR03302 ) outer membrane assembly lipoprotein YfiO
  • ( PF01239 ) Protein prenyltransferase alpha subunit repeat
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR02917 ) putative PEP-CTERM system TPR-repeat lipoprotein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00257190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10200.13.000551941601253e-121hypothetical protein (546 aa)
SGDYFR014C4.0006511639687014e-23CMK1 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk2p and mammalian
Cam Kinase II
OxytrichaContig16009.0.g323.0007793728221555e-22Protein kinase domain
DictyBaseDDB_G02752411.9991095569230066e-20nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000004062.99851380290819e-19locus:cdk-4 status:Confirmed
UniProt:G5EFI3 protein_id
:CAA90447.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00257190(coding)
ATGGAGAATTCTAATGTTTCTAAAAAATTAGAAAGGATCATTCAACTTTTAAAAGACAAA
CAGCATCTAACAGTGGTTAATCCTAATGCTGGCTCAGGAGCATATGGACAGGTTATGACA
GCAAAAGAGGAGAATGGTGAGGAGGTTGCTATAAAGATAGTTTCTGTTTTTGATGAAATT
GACTCCATAGACGAATAAAAGCTTAAGGAAATCAAATCTGAAGCTTAGTTTTTATAGATG
TGTCACCATCCCAACATAGTATCTTATAAAGGGGAATTCCAGCTTGGGAGTTGCTACTTT
ATAAAAATGGAGAAAGGCGAAATGTCTTTGTAAGAATTTGTTGATAAAAAACTCAATTAG
GGAATGTCGGAGAAGCTTTTCGTGAAATTAGCGCTGTAAATGCTTTCTGCAATTTAGTAT
TTACATTCAAAGAATTATGTTCTAAGAGATATATCTTTAAAGAACGTGCTTTTAGACAAG
GATTATAACATTAAGCTTTGTGATTTTGGTTTAGCTAAGGAAATAAATCCTTAGTTGGCA
ACGCAGGCCTTTCTATAATCTCAGGTTAAGGGAGTGCTCTTTTACTTCCCTCCGGAGGTT
TTGGTCATGACTAACTTTAACAGTGAAGAAAAGAAATCGTAAAAAATATACTAAAACTTT
GATGGTGATGTATGGGCGTTTGGAGTATGCATGTATTTGTTAGGAGGAGCTTCATTCCTT
CACGTTTTGTAGCTAACTTAAGGTAAAGAAACTTTTTAGCTCTCTAAGCTGGTGAGCATC
GAAATAAATTAAATACTGCTTAACACGCTTCAGCTAGATCCAAAACTTAGACCATCAATT
GATAAGATAATTTAAGATTTTAAAAATATATAACTCAATTTAGAGAAAGGGAAAGACGAT
GAAATCGGATATTACTTTAATTAGACTGAACTATTTTAGTAGGCTCAAAAGGAAATAGAT
AATCATAAATATTAGGAAGCTTAAGTTACTCTGGAAAGACTTGTAAAGATAAACACACAT
AATGATTAGTACTTAGCATTACTTGGATTAACACACTTGGAACAGTACTAATGTGAAGAG
TCTAGAAGTATAAGCTAGAAATGCTTGTCAATAAACCCAAAAAATGAGATAGCTTTAAGC
TGTATGGGATACTATTATTATGAAAAAAACGATTTAAAGTAAGCGATGTGTTATTTGCAA
AAGTGCTTGAATTTAAACCCAAAAAATTATAGAGCCTTAACTTATAAAGCATTCGTATTA
AGTAATTAATAAAAATTAGATGAAGAGCTATTAACACTTAAAGAAGCAATCAGCTACAAC
CAGAATTATCCTTATTCAATACTGCAAATTGGCAAATGCTATTTCAAGAAAAAAATGTAC
GAAGATGCCATTACCTCTTTTAAGTAAGTAATAAAGTTGCTACCCACAATATTTTCTCCT
TACTATTGTTTAGGAATTATTTATTATGAGAGAAGTGAATTTGATTAGTCTATTTCATAC
TTTAACAAAGCTTTGGAATTGAATTCTTCAAATTAAAATTGCTTGTACAGTTTGGCGAAA
GTCTATTTAGAAACATTCAATTATTCAAACGCAATTGAAATTTTAAATACGTTAGTACGT
CTTTTTCCCAGTAACGATTTGTATTTGGCTACGTTAGCACTAGCTTATTCTGAAATTAAG
GATGAATAGAAAGTGATGGAATTCAGTCAGAAAAGTTTGTAAATAAATCCACAAAATATT
TTAGCTCTTAATTGTTTGGCTTATTACTACTTCTTAAAGTAATAAAATTAATTAGCTATA
TAGTGTTTGCAAAGTTCAATTAAAGTTAACCCTTGCAATTTTAGAGCATACTTCTACTAA
GCATAAATTTTATTGTCCGAAGGCAAACATGAAGATGCTATACTTAGTGCTAAATATTCT
ATGCAACAGAACAGTAAATTCCCTAATGCTTAATTCCTCTTAGGACAAGTGTTTGAGTAA
ATAGGAAAAATGGACAAAGCCATCAAATACTTCCAAGAAGCAATCATGATTTAGGCTAAA
TATGAATTGCCATACATAGATTTATCTTAAATATATCGCAAAAAGGGTTAATACGATGAT
GCCCTTTTCATATGCAAATTAGCTTTACAAAATAATATAAAAAGTGCTAAAATATATAAC
GAGCTAGGAAAAATTTATGAAAAAAAACAATATTTATCTTAAGCAATAAATTATTTCTCA
GAATGTATTTCACTAAAACCTTCTGAACAAATTTATTAAAACAATTTAAAAAACTGTAAA
GAATTATTAAGCAAAAGTAACTCTAAAATAAAAATTTGA


>TTHERM_00257190(protein)
MENSNVSKKLERIIQLLKDKQHLTVVNPNAGSGAYGQVMTAKEENGEEVAIKIVSVFDEI
DSIDEQKLKEIKSEAQFLQMCHHPNIVSYKGEFQLGSCYFIKMEKGEMSLQEFVDKKLNQ
GMSEKLFVKLALQMLSAIQYLHSKNYVLRDISLKNVLLDKDYNIKLCDFGLAKEINPQLA
TQAFLQSQVKGVLFYFPPEVLVMTNFNSEEKKSQKIYQNFDGDVWAFGVCMYLLGGASFL
HVLQLTQGKETFQLSKLVSIEINQILLNTLQLDPKLRPSIDKIIQDFKNIQLNLEKGKDD
EIGYYFNQTELFQQAQKEIDNHKYQEAQVTLERLVKINTHNDQYLALLGLTHLEQYQCEE
SRSISQKCLSINPKNEIALSCMGYYYYEKNDLKQAMCYLQKCLNLNPKNYRALTYKAFVL
SNQQKLDEELLTLKEAISYNQNYPYSILQIGKCYFKKKMYEDAITSFKQVIKLLPTIFSP
YYCLGIIYYERSEFDQSISYFNKALELNSSNQNCLYSLAKVYLETFNYSNAIEILNTLVR
LFPSNDLYLATLALAYSEIKDEQKVMEFSQKSLQINPQNILALNCLAYYYFLKQQNQLAI
QCLQSSIKVNPCNFRAYFYQAQILLSEGKHEDAILSAKYSMQQNSKFPNAQFLLGQVFEQ
IGKMDKAIKYFQEAIMIQAKYELPYIDLSQIYRKKGQYDDALFICKLALQNNIKSAKIYN
ELGKIYEKKQYLSQAINYFSECISLKPSEQIYQNNLKNCKELLSKSNSKIKI


>TTHERM_00257190(gene)
ATGGAGAATTCTAATGTTTCTAAAAAATTAGAAAGGATCATTCAACTTTTAAAAGACAAA
CAGCATCTAACAGTGGTTAATCCTAATGCTGGCTCAGGAGCATATGGACAGGTTATGACA
GCAAAAGAGGAGAATGGTGAGGAGGTTGCTATAAAGATAGTTTCTGTTTTTGATGAAATT
GACTCCATAGACGAATAAAAGCTTAAGGAAATCAAATCTGAAGCTTAGTTTTTATAGATG
TGTCACCATCCCAACATAGTATCTTATAAAGGGGAATTCCAGCTTGGGAGTTGCTACTTT
ATAAAAATGGAGAAAGGCGAAATGTCTTTGTAAGAATTTGTTGATAAAAAACTCAATTAG
GGAATGTCGGAGAAGCTTTTCGTGAAATTAGCGCTGTAAATGCTTTCTGCAATTTAGTAT
TTACATTCAAAGAATTATGTTCTAAGAGATATATCTTTAAAGAACGTGCTTTTAGACAAG
GATTATAACATTAAGCTTTGTGATTTTGGTTTAGCTAAGGAAATAAATCCTTAGTTGGCA
ACGCAGGCCTTTCTATAATCTCAGGTTAAGGGAGTGCTCTTTTACTTCCCTCCGGAGGTT
TTGGTCATGACTAACTTTAACAGTGAAGAAAAGAAATCGTAAAAAATATACTAAAACTTT
GATGGTGATGTATGGGCGTTTGGAGTATGCATGTATTTGTTAGGAGGAGCTTCATTCCTT
CACGTTTTGTAGCTAACTTAAGGTAAAGAAACTTTTTAGCTCTCTAAGCTGGTGAGCATC
GAAATAAATTAAATACTGCTTAACACGCTTCAGCTAGATCCAAAACTTAGACCATCAATT
GATAAGATAATTTAAGATTTTAAAAATATATAACTCAATTTAGAGAAAGGGAAAGACGAT
GAAATCGGATATTACTTTAATTAGACTGAACTATTTTAGTAGGCTCAAAAGGAAATAGAT
AATCATAAATATTAGGAAGCTTAAGTTACTCTGGAAAGACTTGTAAAGATAAACACACAT
AATGATTAGTACTTAGCATTACTTGGATTAACACACTTGGAACAGTACTAATGTGAAGAG
TCTAGAAGTATAAGCTAGAAATGCTTGTCAATAAACCCAAAAAATGAGATAGCTTTAAGC
TGTATGGGATACTATTATTATGAAAAAAACGATTTAAAGTAAGCGATGTGTTATTTGCAA
AAGTGCTTGAATTTAAACCCAAAAAATTATAGAGCCTTAACTTATAAAGCATTCGTATTA
AGTAATTAATAAAAATTAGATGAAGAGCTATTAACACTTAAAGAAGCAATCAGCTACAAC
CAGAATTATCCTTATTCAATACTGCAAATTGGCAAATGCTATTTCAAGAAAAAAATGTAC
GAAGATGCCATTACCTCTTTTAAGTAAGTAATAAAGTTGCTACCCACAATATTTTCTCCT
TACTATTGTTTAGGAATTATTTATTATGAGAGAAGTGAATTTGATTAGTCTATTTCATAC
TTTAACAAAGCTTTGGAATTGAATTCTTCAAATTAAAATTGCTTGTACAGTTTGGCGAAA
GTCTATTTAGAAACATTCAATTATTCAAACGCAATTGAAATTTTAAATACGTTAGTACGT
CTTTTTCCCAGTAACGATTTGTATTTGGCTACGTTAGCACTAGCTTATTCTGAAATTAAG
GATGAATAGAAAGTGATGGAATTCAGTCAGAAAAGTTTGTAAATAAATCCACAAAATATT
TTAGCTCTTAATTGTTTGGCTTATTACTACTTCTTAAAGTAATAAAATTAATTAGCTATA
TAGTGTTTGCAAAGTTCAATTAAAGTTAACCCTTGCAATTTTAGAGCATACTTCTACTAA
GCATAAATTTTATTGTCCGAAGGCAAACATGAAGATGCTATACTTAGTGCTAAATATTCT
ATGCAACAGAACAGTAAATTCCCTAATGCTTAATTCCTCTTAGGACAAGTGTTTGAGTAA
ATAGGAAAAATGGACAAAGCCATCAAATACTTCCAAGAAGCAATCATGATTTAGGCTAAA
TATGAATTGCCATACATAGATTTATCTTAAATATATCGCAAAAAGGGTTAATACGATGAT
GCCCTTTTCATATGCAAATTAGCTTTACAAAATAATATAAAAAGTGCTAAAATATATAAC
GAGCTAGGAAAAATTTATGAAAAAAAACAATATTTATCTTAAGCAATAAATTATTTCTCA
GAATGTATTTCACTAAAACCTTCTGAACAAATTTATTAAAACAATTTAAAAAACTGTAAA
GAATTATTAAGCAAAAGTAACTCTAAAATAAAAATTTGA