Identifiers and Description

Gene Model Identifier

TTHERM_00321740

Standard Name

KIN9 (KINesin )

Aliases

PreTt15992 | 32.m00236

Description

Kinesin-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03789 ) ELK domain
  • ( PF01576 ) Myosin tail
  • ( PF03463 ) eRF1 domain 1
  • ( PF05227 ) CHASE3 domain
  • ( PF02370 ) M protein repeat
  • ( PF00904 ) Involucrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( TIGR01612 ) rhoptry protein
  • ( PF00225 ) Kinesin motor domain
  • ( PF00170 ) bZIP transcription factor
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00612 ) IQ calmodulin-binding motif
  • ( PF00038 ) Intermediate filament protein
  • ( PF01442 ) Apolipoprotein A1/A4/E family
  • ( PF03580 ) herpesvirus UL14-like protein
  • ( PF08272 ) Topoisomerase I zinc-ribbon-like
  • ( TIGR00020 ) peptide chain release factor 2
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06435 ) Repeat of unknown function (DUF1079)
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF07200 ) Modifier of rudimentary (Mod(r)) protein
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF07052 ) Hepatocellular carcinoma-associated antigen 59
  • ( PF05852 ) Gammaherpesvirus protein of unknown function
  • ( PF04513 ) Baculovirus polyhedron envelope protein, PEP,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00321740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10070.19.997093137033517e-262kinesin motor domain-containin
g protein (2207 aa)
OxytrichaContig7647.0.g331.0002646133906571e-103Kinesin motor domain
DictyBaseDDB_G02815555.001369568193564e-73kif7 on chromosome: 3 position
4819674 to 4823774
WormBaseWBGene000022302.0007889996237956e-71locus:klp-20 status:Confirme
d UniProt:Q965T6 protein_i
d:CCD73793.1
Stentor CoeruleusSteCoe_192473.817497188671175e-54
SGDYGL216W4.001202823045957e-54KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00321740(coding)
ATGAAGAGAAATGCTTTTTTAGATAACGACGCGCCCTAAGCTGCCAATTAATTGAGTCCT
ATTAGCATGCCAAGTCCAAAATAAATTAGTGGAAACTAAAATATTGCAGGCTTAGCTTAA
AATAATTCAGAAAAATAACTTGAAACAACTAATAAAAAGCAAGAAAAGGTCAAGGTTTTT
GTGCGTCTTAGACCATTTTTGGAAGAAGAATATAATCAGTGCAAGCAATGCAGTATTGAA
AGCTTTGACTCAAAAAATAAAATAATAGCTATAAAAAAAGATTATGAAAAGAAGGTATTT
AATTTTGATGGAATTTTCGAGCCTAAAGTTTCTTAGCAGGATATATATAAATAAGTCGCA
TAGCCTGTTATTCAAAGTGTTTTGTAGGGGTTTAATGGCACTATATTCGCTTATGGTTAA
ACAGGAACAGGCAAAACTTTTACTATGCTCGGAGGTTCAAAAGATTAGGATATAGGCATA
ATTCCAAGAGGTTTACAAGATATTTTTAACTATGCTGAAGAAGATATTAGCAATATTTAT
TCTATTTAATTAAGTTGTGTTTAAATATACATGGAAATGCTCTAAGATTTAATCAATCCA
GAGAATTAAGTTATTAGAATCAGGGAATCACCTGAAAACGGAGTATTTGTTTCTGGAATA
GAATGGGTTATAATTCAAAATCCTTAAGAAGCCCTTCAACTTCTAGGACTCGCTGAGAAA
AATAGGGCAGTTGCTTTTACAGCACTGAATGCTTGCTCTAGCAGAAGTCATGTTATATTA
ATGGTTTAAGTATAGAAGAGAAGCAAGAAGGTTATTGAAGAGTAATCAAAATGCAATAGT
CTTAATAACTCATTAGTTCAATATAATACTAATTCATTTTTACAAAATGAGGATCTTAAT
GTTATGAATTAAATTAATAGCAATAATAACAGTATTTCTCTTGTTACTTCGATTTTGTAC
ATGGTAGATCTGGCTGGTTCAGAGAGAGTTAAGAAGTCTAAATCTACTGGAGATAGATTA
CATGAAGCTAAAGCTATTAATAGCTCATTAAGTGCTTTAGGAAAATGTATCTCAGCTCTT
TCAGATGGCAGATCTAACTTTGTTCCTTTCAGAGAATCCAAGCTTACTCGTCTTTTGTAA
GATTCTTTGGGAGGAAACTCAAAGACATCTTTAGTTGTTACTATTGGACCATCAGCTAAG
CATTTGGATGAAACAATTTCCTCATTAGCTTTTGGACAAAGAGCTATGAAGGTTACTAAT
AAACCAATAGTGAATAAACAGAAAGACTACTATCTGCTTTCGATGCAATTACAATAAGAA
TTAGATGGAAAAGATGACTAAATTCATAAAATGGAAATATTTTAATAGTAAATGGTAAAG
AAAATTATGGAATTATAAGAGGACTTAAATAAAGTGAAGCTTGATAAATAAGAACTAGAA
GGAAGTTAGAGACATTTAAAATAGAGCTTATGCTAGGGAGTTAAATAACAAGATACGATA
GTATTGCTCGAATAATAGAAAAAAGTTGAAGTTGAAAATATTGAAAAAAAATATTAAGAA
CTTTTAAAACAAACTGAAAATGAATTAAAATCTTTTTTAGAAGAATTCGATAAAACTTCT
CTTGAATATGAAGAAGAGATAGATCAGTTAAAAGAATAAAATATAAAGTACTTACAAGAT
ATTGAAAATTATGCTAAGCAAACAGAGTCTTTAAATGACTAGCTTAAATAAAAGAATGAA
GAAATAGTCAACTTAGAAAATACCTACAAGAATTTGGAATCAGAAAAAGAAAACAGTGAA
CAATAGTTCATAGAGCTATCTTAGTAATTCAAATTAATTGACAATGGCTATAAAGAAAGG
GAAGAAAATTACAAGAAGCAAATAAAAATGAATGAGCAAAAAGCTAGTTTAAAAGAGAAA
GAAAATGTGTCACTTAAAGAATAGCTAAAATAATAAGAAAATGCATAATCTTAAGCACTT
AATACCTTGAAGGAAGAAATCTAGGAATTGTCTAAGCAAAATAAAGTGTTATAGGAAGAG
CTAAATAAGAAGACAATATCTATTTCAGAGAGAGAAAAGCAGCATTTACAAGAGCTTGAT
ATAGTCAAGAGCGAATACACATCTCAGTTTGATTATTTAAACTCTGAAAGAGAAAGTTTG
AAAAGCTCATTAGAGAAAGGCAGAGTTGACTTGGAATAAGAACTAAAATAGGCTAGAGAG
TAAATTGAAAAACAAAAACAAGAGATAGTTGAGTATGAAAAGATTGTAAATGAGTCTAAT
GAAGAAAAGAGTATGATGATGCAGCAATTAGAAATTAAGATAGACGAACTTATTTAGCAT
AATAAAAGAGAAATTGCATCTATGAAAAAATAACTGACTGAAAAAGATTAATACATTTAA
AATTAAAAGAATTCCTATGAATAACTTTTGAATAAATATAATGAACTTTAGGAAGATTAT
GAAGATTGCTAAGAGTAGCAAAGTGAAGAAATATAAAAAAATAAAAATTTAATAAAAGAA
AAAGAAGAAAAATTATAATAGGTCTAATAATAATTAGAGGAGTAATTGTAGGATTATGAT
TAGAAATCAAGTTCTTATCAGAGTTAAATTGAGTAGCTTAATTAAAATATTGAGTAACTT
AATCAAAAAATCGAGCAACTTATTGAATAGAAATAGTAAATGGAAAGTTAATTTGAGATA
GACATAGAGCAGTACAAAAATAAAAACTAGTAAGATTTAGAAAATTTGAATATTAAAACA
GCCTAAAGCTAGCTTTAGAGCGAAGCTATCTTGAAATAGTTTAACTAATAAATAGAATAA
CTAAATTTAACTAATAGTTAGAAAGACTAGTTAATAGCTAAACAAAAAGAATAGATAGAA
TAATAGACTGAGTAGCTTGATAAGTTAAATACAGAGCTATCTGAATAGTCTAGTTAGTTA
AGTTTGATTTAAATAAATAACTAAGAATTAATAATTCAATTAGATGAAACAGAGAAACAA
CTCAACACTCAAAAATAATAATTAAATCACTCATAATAACAAATAACTGACCTTAAGAAA
GAAATTTCTATTTTGAATCAGGAAATATTTGACAGAAAGAAAGAAATAGAATCATATGTC
AAATCGAATAATTAATTTGAATAGAAAATTGAGTAGCTGAAGTAAGAGATAGTTGTCAAA
GAGTTTTAGCATGAAAATGAAATACAAGAGAAAAAGGACATGCTTCAAGAGCATTTAATT
CAATTTAAAGATAAAGAAGAAGAGTTAAAGTAAGCAAGAGAAGATATTATCAATGAAAAG
AATAGCTTTGAAGTTGTTCTTAAATCCATTTAAAATCAAAATTCTGAGCTAGAATAAAAA
ATTGTTGATTTGAAAAATGATAAAGAAAGATTATAATTAATTGTTGAGGAAAAGGAAAAA
GTCATTTTAGATTTATAAAGTTAGTTATAAGAAAAATGTTCTTAAATTTAGCAGATTTCT
GAAATATCCAGTGAAATAGAAACAGCTTTAGAGTAAAAACAATAACATATCTAACTTCTG
CTTTTAAAGAACACCTAAGTCGAAGATTAAATAAATAATTTAAAGGATTAAATTCTCGAT
CTAGAAGAAATAAATAAGCAGAATGTTGAGAAACAAGAAAACCTTCAAACATAACTTTAG
TAAAAAAGCATATAATAATAAGAATAAAATGAATAAAATGCAGAATAGGTGTGTTAGTTA
AATGCTTAAATAGCACAATTAAATTAAGAGCTTGAAGATAAAATTAATAATTTATAAAAA
TTAAATTAAACTTATTTGGATTAAATTAGAGAAATAAAAGAAATTTTAGATGCTAAAAAT
AATGAAATCGAGTCTTTGAAATTAAGTTAGTAATAAATTGAATTATCTATGGGTGAACTT
AAAAGCATTTTTGAAGAGTCAGAGTCAAATTTATAATAAAAAAATACCGAAAATGAAAAT
TTAAAGGACAAGATAAAGGAATTAACAGAAAAAGCTAATGAATATGAAAATGAAATGAAA
GAATAGAATGATGAAATTAATCAATTAACTGAAAGTAATAAAGAAATTTAAGGTTAACTT
CAATCTGAAATAGAAAATTTAAACCAATAGCTTGAATCTCATTAACAAGAAATAGCAGAA
TTGAAGGGCTAATTGGATATTTAAATCCAGTTAGTTTCTGAAGGTGAGAATTTAAATCAA
AATTAATAACTTGAAATAGAATAAAAAATTGCTTAAATGATAGAGTAAGAAAATTAAGTC
AAGCAATTTTAATTAAAGGCATAAATAAATGAAGAGCGTATTATGATATTAGAAAAATAA
GTCCAAGCAAAGTAATAAGCAATTGAGGAGAAAATGGAAGAAATCAAGAAACATAAAGAA
AATGTTGAACAGGTTCTCTAAACTGAAATAAACGACAAATAATCTATTATCAATGAATAC
TAAGAAAAGTTCATTGAACAAGAGAGTTTATAAAAGTAACTAGAAGATTAGATAGAATAA
ATTGTCAATTAATATGAAGTAAAACTAGAAACAAAGCAAACAGAAATAGAAGAGCTATAA
AACTAATACGAAGATTTGCATAATTAATTTGAAGCATTTTAATAAGAATCTAATGAACAA
TTTTAATTTAATATCAAAAAACTTGAATCATAAAATGAAGAATTGAAAGAATAAATTGAA
AATCTGAATGAAAAAATGTGTTTAGAAATTTAAGATAAAGAATAATAAAAGTAAAATAAT
GAAAATCTTTTAAGTTAAATCTAAAGCATTAAAGATGAAAACTCTAAAAAAATAGAAGAA
CTTGAGTTAATAATAATTAGTGAAAAATAACAAGTAGAATAGTTGAATTTAAAAATTAGT
GATTTGAATCTATAAAATTAAAAATTACTTGAGTAGTTAAAGCAAGTTGAATTAGAGAAT
GCTAAAAAAATTAATAATCTGTAAATTGATTTAGAGGATAAAATTAACTTGATTCATGTT
TAGACTCAATAATTATCTTGCATGATAATTTAGAATGCTTTTAGAAGGATTTAAAAGTAG
AAAATAATTAAGAGATATCTTAATCAACTAGCTTTAAAAACAAGGAAATTAAATGCAGAA
TAAAATAAACTGGAATAGGCCGAAATAGAGAATAAAAAATAATATGATTAATTGCTTTAT
TAAGCTGAACTAGATACTTATTTGCAAGAATAAATTAAAAAACTTAATGAGTAAAATGAT
GAAATTAATTAAAGAATTTAACAATAGGATTAAATTTTATAAGAAAATGAAAAACAACTT
AAAAAGCTATAAATAGAAAAAGATTCTGATACCTAATAAATGAATTTTTATATTGAAAAA
ATATCTAATTTAAATTAAGATATCAAGGCTAAGGAGGAACAGCTTGCATAATCTTATGAT
GAGTTATCTAATTTATCAAAATAATTAAGAATTTGCACAAATTCAGTTGAAGAATTATAA
TTCTAATTAAAGAATATTAAGTCATAGTCTGTGCATGACAATATCGATTTTAAAGTGAGA
AAGATATAGATTACTTTCTAGAAACACTTGCTAAGAAAAGAATTGAATGCTGCTATAAGC
AATAATGAATAGCTTTAACAAAATGTAGATGATTTAATTTAGAAGAATACTCTCTTATAA
TATCAAAATGAAGAATTTAGCATTACAAATAAATAAGCACTTGATTAGATTTAAGACGAA
TAAAATAAGATAGTGGAATTATAACTCGAATTGAAAGAAAAAAACACCTGTATTGAGAAA
GTCTAGCAAATGATTGAAAAAAGGGAAACAAATTTAACAGAATTAGAAAATAAAATTATC
AATTTAGAATAGCTGTAAAAAGAAAATTAAGTTATCATAAACCAATAGTTTAAATAGCTC
AATGAATAAAATTATAAATTTAAATGTATGAATTCAATTAGAGTTATTTCAAAGTTTATT
GCTTAAAAAAAATGGTAACAAACAGTTAAAAAATTAATGGGAGCATTTGCAATTTAGAAG
ATTCATTTTGAAAAATAAATTGAAGTTTTAGATGAGAAAGTTGCTGGCTATCAAATAATG
AAATTATTAAAATAAAGAGTTTCTGAATAATAGCTAAACCAATATAATAGATTAATTATA
GAAAGACAAAAAACTATTGAATTTTTACAATCATAAGTAGAAAAGGAGCAATACATATTC
AGAAAAGCAAGCCAAGTTTATGAGAGAGAAGTTAGTGCTAGAAAAATACAATCTGCTTAT
AGGTTATTCAAGGTTAATTAGATATTATACAGATATAAATAATAGATTGATAATTTGAGA
AAAATAAATTACGATTACAAAGAAAAAATAGACAGACTTTAAGAATAACTCTATGATTTA
GAAGATGAAATTGAAAAAGAAAAAAGTGTTATCTCTTAATAATAAAATGAATAAGTCTTC
CAAGAGAGAGGATTCTTATAAGAAAACATAAATTTATTAAACACTGAATTCAAAAAAAAT
GAACCTCAAAGAGGAAGTAGAGAAAATTAGATTTCTTCACTATAAAAATCAGAAAAAACA
CTGAAGTAAAAACTGAAAGAATTAGATTAAAGCTGGAAGAATCAATATACTCATTTAGAA
AATAAGCACTTAGAGCTTTAAAAAGATAAATAAATACTGACTGAAAGTTATGAACAAACT
CTTGCTATAATAAAAAAAGATAAAGCCCTGCTCATTGAGTATTAAAATTAAATTGAGATA
AATAGAAGATAAGATAAAGCAGCAAGAATTATATAAAATTATGTTAAAAATAGAAAGCTT
TAATAAGAACAAGAGAAATTATAAAAAGAAAAAGAAGATCTTTCAAAGATATTCAAGTTA
AAAAATGCTTAGACAGGTTAATATTTATTCCAACAATCTTTGAAGAATGTTAATTAGATT
TTTACTAACCTAATATAAAACTTTACTAACCCAAACTAGTGA


>TTHERM_00321740(protein)
MKRNAFLDNDAPQAANQLSPISMPSPKQISGNQNIAGLAQNNSEKQLETTNKKQEKVKVF
VRLRPFLEEEYNQCKQCSIESFDSKNKIIAIKKDYEKKVFNFDGIFEPKVSQQDIYKQVA
QPVIQSVLQGFNGTIFAYGQTGTGKTFTMLGGSKDQDIGIIPRGLQDIFNYAEEDISNIY
SIQLSCVQIYMEMLQDLINPENQVIRIRESPENGVFVSGIEWVIIQNPQEALQLLGLAEK
NRAVAFTALNACSSRSHVILMVQVQKRSKKVIEEQSKCNSLNNSLVQYNTNSFLQNEDLN
VMNQINSNNNSISLVTSILYMVDLAGSERVKKSKSTGDRLHEAKAINSSLSALGKCISAL
SDGRSNFVPFRESKLTRLLQDSLGGNSKTSLVVTIGPSAKHLDETISSLAFGQRAMKVTN
KPIVNKQKDYYLLSMQLQQELDGKDDQIHKMEIFQQQMVKKIMELQEDLNKVKLDKQELE
GSQRHLKQSLCQGVKQQDTIVLLEQQKKVEVENIEKKYQELLKQTENELKSFLEEFDKTS
LEYEEEIDQLKEQNIKYLQDIENYAKQTESLNDQLKQKNEEIVNLENTYKNLESEKENSE
QQFIELSQQFKLIDNGYKEREENYKKQIKMNEQKASLKEKENVSLKEQLKQQENAQSQAL
NTLKEEIQELSKQNKVLQEELNKKTISISEREKQHLQELDIVKSEYTSQFDYLNSERESL
KSSLEKGRVDLEQELKQAREQIEKQKQEIVEYEKIVNESNEEKSMMMQQLEIKIDELIQH
NKREIASMKKQLTEKDQYIQNQKNSYEQLLNKYNELQEDYEDCQEQQSEEIQKNKNLIKE
KEEKLQQVQQQLEEQLQDYDQKSSSYQSQIEQLNQNIEQLNQKIEQLIEQKQQMESQFEI
DIEQYKNKNQQDLENLNIKTAQSQLQSEAILKQFNQQIEQLNLTNSQKDQLIAKQKEQIE
QQTEQLDKLNTELSEQSSQLSLIQINNQELIIQLDETEKQLNTQKQQLNHSQQQITDLKK
EISILNQEIFDRKKEIESYVKSNNQFEQKIEQLKQEIVVKEFQHENEIQEKKDMLQEHLI
QFKDKEEELKQAREDIINEKNSFEVVLKSIQNQNSELEQKIVDLKNDKERLQLIVEEKEK
VILDLQSQLQEKCSQIQQISEISSEIETALEQKQQHIQLLLLKNTQVEDQINNLKDQILD
LEEINKQNVEKQENLQTQLQQKSIQQQEQNEQNAEQVCQLNAQIAQLNQELEDKINNLQK
LNQTYLDQIREIKEILDAKNNEIESLKLSQQQIELSMGELKSIFEESESNLQQKNTENEN
LKDKIKELTEKANEYENEMKEQNDEINQLTESNKEIQGQLQSEIENLNQQLESHQQEIAE
LKGQLDIQIQLVSEGENLNQNQQLEIEQKIAQMIEQENQVKQFQLKAQINEERIMILEKQ
VQAKQQAIEEKMEEIKKHKENVEQVLQTEINDKQSIINEYQEKFIEQESLQKQLEDQIEQ
IVNQYEVKLETKQTEIEELQNQYEDLHNQFEAFQQESNEQFQFNIKKLESQNEELKEQIE
NLNEKMCLEIQDKEQQKQNNENLLSQIQSIKDENSKKIEELELIIISEKQQVEQLNLKIS
DLNLQNQKLLEQLKQVELENAKKINNLQIDLEDKINLIHVQTQQLSCMIIQNAFRRIQKQ
KIIKRYLNQLALKTRKLNAEQNKLEQAEIENKKQYDQLLYQAELDTYLQEQIKKLNEQND
EINQRIQQQDQILQENEKQLKKLQIEKDSDTQQMNFYIEKISNLNQDIKAKEEQLAQSYD
ELSNLSKQLRICTNSVEELQFQLKNIKSQSVHDNIDFKVRKIQITFQKHLLRKELNAAIS
NNEQLQQNVDDLIQKNTLLQYQNEEFSITNKQALDQIQDEQNKIVELQLELKEKNTCIEK
VQQMIEKRETNLTELENKIINLEQLQKENQVIINQQFKQLNEQNYKFKCMNSIRVISKFI
AQKKWQQTVKKLMGAFAIQKIHFEKQIEVLDEKVAGYQIMKLLKQRVSEQQLNQYNRLII
ERQKTIEFLQSQVEKEQYIFRKASQVYEREVSARKIQSAYRLFKVNQILYRYKQQIDNLR
KINYDYKEKIDRLQEQLYDLEDEIEKEKSVISQQQNEQVFQERGFLQENINLLNTEFKKN
EPQRGSRENQISSLQKSEKTLKQKLKELDQSWKNQYTHLENKHLELQKDKQILTESYEQT
LAIIKKDKALLIEYQNQIEINRRQDKAARIIQNYVKNRKLQQEQEKLQKEKEDLSKIFKL
KNAQTGQYLFQQSLKNVNQIFTNLIQNFTNPNQ


>TTHERM_00321740(gene)
ATGAAGAGAAATGCTTTTTTAGATAACGACGCGCCCTAAGCTGCCAATTAATTGAGTATT
TTAATTTTTTAGTTGTTTAGTATTAATAATAAATTTATATTATTTTAATCAGGTCCTATT
AGCATGCCAAGTCCAAAATAAATTAGTGGAAACTAAAATATTGCAGGCTTAGCTTAAAAT
AATTCAGAAAAATAACTTGAAACAACTAATAAAAAGCAAGAAAAGGTCAAGGTTTTTGTG
CGTCTTAGACCATTTTTGGAAGAAGAATATAATCAGTGCAAGCAATGCAGTATTGAAAGC
TTTGACTCAAAAAATAAAATAATAGCTAGTAAATAAAATTATTTAAAAACAGAAAATACA
GAAAAATTTTATGTTTTTATGAAATAGTAAAAAAAGATTATGAAAAGAAGGTATTTAATT
TTGATGGAATTTTCGAGCCTAAAGTTTCTTAGCAGGATATATATAAATAAGTCGCATAGC
CTGTTATTCAAGTATTATAAATATTCAATTTTAAAAACTTATTAAGGTTATTAATTAATA
AATAAAAAAGAGTGTTTTGTAGGGGTTTAATGGCACTATATTCGCTTATGGTTAAACAGG
AACAGGCAAAACTTTTACTATGCTCGGAGGTTCAAAAGATTAGGATATAGGCATAATTCC
AAGAGGTTTACAAGATATTTTTAACTATGCTGAAGAAGATATTAGCAATATTTATTCTAT
TTAATTAAGTTGTGTTTAAATATACATGGAAATGGTAGAACTAAATTTTTCCTTTCTTGA
TTTATATAAAATAAATTTTATAATAATAATAATAAATAGCTCTAAGATTTAATCAATCCA
GAGAATTAAGTTATTAGAATCAGGGAATCACCTGAAAACGGAGTATTTGTTTCTGGAATA
GAATGGGTTATAATTCAAAATCCTTAAGAAGCCCTTCAACTTCTAGGACTCGCTGAGAAA
AATAGGGCAGTTGCTTTTACAGCGTAATTAATTTATTTGCTATTTAAATAAAATAAAAGA
TGTTTTTTATCATTTTTTAATTACAATAGACTGAATGCTTGCTCTAGCAGAAGTCATGTT
ATATTAATGGTTTAAGTATAGAAGAGAAGCAAGAAGGTTATTGAAGAGTAATCAAAATGC
AATAGTCTTAATAACTCATTAGTTCAATATAATACTAATTCATTTTTACAAAATGAGGAT
CTTAATGTTATGAATTAAATTAATAGCAATAATAACAGTATTTCTCTTGTTACTTCGATT
TTGTACATGGTAGATCTGGCTGGTTCAGAGAGAGTTAAGAAGTCTAAATCTACTGGAGAT
AGATTACATGAAGCTAAAGCTATTAATAGCTCATTAAGTGCTTTAGGAAAATGTATCTCA
GCTCTTTCAGATGGCAGATCTAACTTTGTTCCTTTCAGAGAATCCAAGCTTACTCGTCTT
TTGTAAGATTCTTTGGGAGGAAACTCAAAGACATCTTTAGTTGTTACTATTGGACCATCA
GCTAAGCATTTGGATGAAACAATTTCCTCATTAGCTTTTGGACAAAGAGCTATGAAGGTT
ACTAATAAACCAATAGTGAATAAACAGAAAGACTACTATGTAAAAATATAATTTTCTTGT
TAACTTTTTTAATGTTAATTTTTAAAAAATAAAGCTGCTTTCGATGCAATTACAATAAGA
ATTAGATGGAAAAGATGACTAAATTCATAAAATGGAAATATTTTAATAGTAAATGGTAAA
GAAAATTATGGAATTATAAGAGGACTTAAATAAAGTGAAGCTTGATAAATAAGAACTAGA
AGGAAGTTAGAGACATTTAAAATAGAGCTTATGCTAGGGAGTTAAATAACAAGATACGAT
AGTATTGCTCGAATAATAGAAAAAAGTTGAAGTTGAAAATATTGAAAAAAAATATTAAGA
ACTTTTAAAACAAACTGAAAATGAATTAAAATCTTTTTTAGAAGAATTCGATAAAACTTC
TCTTGAATATGAAGAAGAGATAGATCAGTTAAAAGAATAAAATATAAAGTACTTACAAGA
TATTGAAAATTATGCTAAGCAAACAGAGTCTTTAAATGACTAGCTTAAATAAAAGAATGA
AGAAATAGTCAACTTAGAAAATACCTACAAGAATTTGGTAAATTTTAAATAAGAATATGA
GAAATATGTATTGGATTAACATTTTATTTTAATTAATCATTTATAAAGGAATCAGAAAAA
GAAAACAGTGAACAATAGTTCATAGAGCTATCTTAGTAATTCAAATTAATTGACAATGGC
TATAAAGAAAGGGAAGAAAATTACAAGAAGCAAATAAAAATGAATGAGCAAAAAGCTAGT
TTAAAAGAGAAAGAAAATGTGTCACTTAAAGAATAGCTAAAATAATAAGAAAATGCATAA
TCTTAAGCACTTAATACCTTGAAGGAAGAAATCTAGGAATTGTCTAAGCAAAATAAAGTG
TTATAGGAAGAGCTAAATAAGAAGACAATATCTATTTCAGAGAGAGAAAAGCAGCATTTA
CAAGAGCTTGATATAGTCAAGAGCGAATACACATCTCAGTTTGATTATTTAAACTCTGAA
AGAGAAAGTTTGAAAAGCTCATTAGAGAAAGGCAGAGTTGACTTGGAATAAGAACTAAAA
TAGGCTAGAGAGTAAATTGAAAAACAAAAACAAGAGATAGTTGAGTATGAAAAGATTGTA
AATGAGTCTAATGAAGAAAAGAGTATGATGATGCAGCAATTAGAAATTAAGATAGACGAA
CTTATTTAGCATAATAAAAGAGAAATTGCATCTATGAAAAAATAACTGACTGAAAAAGAT
TAATACATTTAAAATTAAAAGAATTCCTATGAATAACTTTTGAATAAATATAATGAACTT
TAGGAAGATTATGAAGATTGCTAAGAGTAGCAAAGTGAAGAAATATAAAAAAATAAAAAT
TTAATAAAAGAAAAAGAAGAAAAATTATAATAGGTCTAATAATAATTAGAGGAGTAATTG
TAGGATTATGATTAGAAATCAAGTTCTTATCAGAGTTAAATTGAGTAGCTTAATTAAAAT
ATTGAGTAACTTAATCAAAAAATCGAGCAACTTATTGAATAGAAATAGTAAATGGAAAGT
TAATTTGAGATAGACATAGAGCAGTACAAAAATAAAAACTAGTAAGATTTAGAAAATTTG
AATATTAAAACAGCCTAAAGCTAGCTTTAGAGCGAAGCTATCTTGAAATAGTTTAACTAA
TAAATAGAATAACTAAATTTAACTAATAGTTAGAAAGACTAGTTAATAGCTAAACAAAAA
GAATAGATAGAATAATAGACTGAGTAGCTTGATAAGTTAAATACAGAGCTATCTGAATAG
TCTAGTTAGTTAAGTTTGATTTAAATAAATAACTAAGAATTAATAATTCAATTAGATGAA
ACAGAGAAACAACTCAACACTCAAAAATAATAATTAAATCACTCATAATAACAAATAACT
GACCTTAAGAAAGAAATTTCTATTTTGAATCAGGAAATATTTGACAGAAAGAAAGAAATA
GAATCATATGTCAAATCGAATAATTAATTTGAATAGAAAATTGAGTAGCTGAAGTAAGAG
ATAGTTGTCAAAGAGTTTTAGCATGAAAATGAAATACAAGAGAAAAAGGACATGCTTCAA
GAGCATTTAATTCAATTTAAAGATAAAGAAGAAGAGTTAAAGTAAGCAAGAGAAGATATT
ATCAATGAAAAGAATAGCTTTGAAGTTGTTCTTAAATCCATTTAAAATCAAAATTCTGAG
CTAGAATAAAAAATTGTTGATTTGAAAAATGATAAAGAAAGATTATAATTAATTGTTGAG
GAAAAGGAAAAAGTCATTTTAGATTTATAAAGTTAGTTATAAGAAAAATGTTCTTAAATT
TAGCAGATTTCTGAAATATCCAGTGAAATAGAAACAGCTTTAGAGTAAAAACAATAACAT
ATCTAACTTCTGCTTTTAAAGAACACCTAAGTCGAAGATTAAATAAATAATTTAAAGGAT
TAAATTCTCGATCTAGAAGAAATAAATAAGCAGAATGTTGAGAAACAAGAAAACCTTCAA
ACATAACTTTAGTAAAAAAGCATATAATAATAAGAATAAAATGAATAAAATGCAGAATAG
GTGTGTTAGTTAAATGCTTAAATAGCACAATTAAATTAAGAGCTTGAAGATAAAATTAAT
AATTTATAAAAATTAAATTAAACTTATTTGGATTAAATTAGAGAAATAAAAGAAATTTTA
GATGCTAAAAATAATGAAATCGAGTCTTTGAAATTAAGTTAGTAATAAATTGAATTATCT
ATGGGTGAACTTAAAAGCATTTTTGAAGAGTCAGAGTCAAATTTATAATAAAAAAATACC
GAAAATGAAAATTTAAAGGACAAGATAAAGGAATTAACAGAAAAAGCTAATGAATATGAA
AATGAAATGAAAGAATAGAATGATGAAATTAATCAATTAACTGAAAGTAATAAAGAAATT
TAAGGTTAACTTCAATCTGAAATAGAAAATTTAAACCAATAGCTTGAATCTCATTAACAA
GAAATAGCAGAATTGAAGGGCTAATTGGATATTTAAATCCAGTTAGTTTCTGAAGGTGAG
AATTTAAATCAAAATTAATAACTTGAAATAGAATAAAAAATTGCTTAAATGATAGAGTAA
GAAAATTAAGTCAAGCAATTTTAATTAAAGGCATAAATAAATGAAGAGCGTATTATGATA
TTAGAAAAATAAGTCCAAGCAAAGTAATAAGCAATTGAGGAGAAAATGGAAGAAATCAAG
AAACATAAAGAAAATGTTGAACAGGTTCTCTAAACTGAAATAAACGACAAATAATCTATT
ATCAATGAATACTAAGAAAAGTTCATTGAACAAGAGAGTTTATAAAAGTAACTAGAAGAT
TAGATAGAATAAATTGTCAATTAATATGAAGTAAAACTAGAAACAAAGCAAACAGAAATA
GAAGAGCTATAAAACTAATACGAAGATTTGCATAATTAATTTGAAGCATTTTAATAAGAA
TCTAATGAACAATTTTAATTTAATATCAAAAAACTTGAATCATAAAATGAAGAATTGAAA
GAATAAATTGAAAATCTGAATGAAAAAATGTGTTTAGAAATTTAAGATAAAGAATAATAA
AAGTAAAATAATGAAAATCTTTTAAGTTAAATCTAAAGCATTAAAGATGAAAACTCTAAA
AAAATAGAAGAACTTGAGTTAATAATAATTAGTGAAAAATAACAAGTAGAATAGTTGAAT
TTAAAAATTAGTGATTTGAATCTATAAAATTAAAAATTACTTGAGTAGTTAAAGCAAGTT
GAATTAGAGAATGCTAAAAAAATTAATAATCTGTAAATTGATTTAGAGGATAAAATTAAC
TTGATTCATGTTTAGACTCAATAATTATCTTGCATGATAATTTAGAATGCTTTTAGAAGG
ATTTAAAAGTAGAAAATAATTAAGAGATATCTTAATCAACTAGCTTTAAAAACAAGGAAA
TTAAATGCAGAATAAAATAAACTGGAATAGGCCGAAATAGAGAATAAAAAATAATATGAT
TAATTGCTTTATTAAGCTGAACTAGATACTTATTTGCAAGAATAAATTAAAAAACTTAAT
GAGTAAAATGATGAAATTAATTAAAGAATTTAACAATAGGATTAAATTTTATAAGAAAAT
GAAAAACAACTTAAAAAGCTATAAATAGAAAAAGATTCTGATACCTAATAAATGAATTTT
TATATTGAAAAAATATCTAATTTAAATTAAGATATCAAGGCTAAGGAGGAACAGCTTGCA
TAATCTTATGATGAGTTATCTAATTTATCAAAATAATTAAGAATTTGCACAAATTCAGTT
GAAGAATTATAATTCTAATTAAAGAATATTAAGGTATTTTATTATCATTTATTATTAAAT
ATACTTATTTTTTTTAATAAAAGTCATAGTCTGTGCATGACAATATCGATTTTAAAGTGA
GAAAGATATAGATTACTTTCTAGAAACACTTGCTAAGAAAAGAATTGAATGCTGCTATAA
GCAATAATGAATAGCTTTAACAAAATGTAGATGATTTAATTTAGAAGAATACTCTCTTAT
AATATCAAAATGAAGAATTTAGCATTACAAATAAATAAGCACTTGATTAGATTTAAGACG
AATAAAATAAGATAGTGGAATTATAACTCGAATTGAAAGAAAAAAACACCTGTATTGAGA
AAGTCTAGCAAATGATTGAAAAAAGGGAAACAAATTTAACAGAATTAGAAAATAAAATTA
TCAATTTAGAATAGCTGTAAAAAGAAAATTAAGTTATCATAAACCAATAGTTTAAATAGC
TCAATGAATAAAATTATAAATTTAAATGTATGAATTCAATTAGAGTTATTTCAAAGTTTA
TTGCTTAAAAAAAATGGTAACAAACAGTTAAAAAATTAATGGGAGCATTTGCAATTTAGA
AGATTCATTTTGAAAAATAAATTGAAGTAAAAAATTTGTTTATTTTTTTGTCATTTAAAT
TTATTTATCATTAAAAAATAAATTTTAGGTTTTAGATGAGAAAGTTGCTGGCTATCAAAT
AATGAAATTATTAAAATAAAGAGTTTCTGAATAATAGCTAAACCAATATAATAGATTAAT
TATAGAAAGACAAAAAACTATTGAATTTTTACAATCATAAGTAGAAAAGGAGCAATACAT
ATTCAGAAAAGCAAGCCAAGTTTATGAGGTATTTTTTATTTATTAGAAAATTTTGTATTT
TTATTAAAACTTTTTCATTAAATAGAGAGAAGTTAGTGCTAGAAAAATACAATCTGCTTA
TAGGTTATTCAAGGTTAATTAGATATTATACAGATATAAATAATAGATTGATAATTTGAG
AAAAATAAATTACGATTACAAAGAAAAAATAGACAGACTTTAAGAATAACTCTATGATTT
AGAAGATGAAATTGAAAAAGAAAAAAGTGTTATCTCTTAATAATAAAATGAATAAGTCTT
CCAAGAGAGAGGATTCTTATAAGAAAACATAAATTTATTAGTAATCAAATTTGTAAATCA
ATTTTTAAAACTTATTTTTATTCTTTAAAAAAGAACACTGAATTCAAAAAAAATGAACCT
CAAAGAGGAAGTAGAGAAAATTAGATTTCTTCACTATAAAAATCAGAAAAAACACTGAAG
TAAAAACTGAAAGAATTAGATTAAAGCTGGAAGAATCAATATACTCATTTAGAAAATAAG
CACTTAGAGCTTTAAGTAACAGTTTAAAAATATTAAAAAAACATTTTTATTGAGTTTAAT
TTTTAAATTTGAAAATAAAAATAGAAAGATAAATAAATACTGACTGAAAGTTATGAACAA
ACTCTTGCTATAATAAAAAAAGATAAAGCCCTGCTCATTGAGTATTAAAATTAAATTGAG
ATAAATAGAAGATAAGATAAAGCAGCAAGAATTATATAAAATTATGTTAAAAATAGAAAG
CTTTAATAAGAACAAGAGGTAAAATTAATAAATATTGCTTTTCTTATTTAAAAACCATTT
TAAATAGAAATTATAAAAAGAAAAAGAAGATCTTTCAAAGATATTCAAGTTAAAAAATGC
TTAGACAGGTTAATATTTATTCCAACAATCTTTGAAGAATGTTAATTAGATTTTTACTAA
CCTAATATAAAACTTTACTAACCCAAACTAGTGA