Identifiers and Description

Gene Model Identifier

TTHERM_00014920

Standard Name

KIN8 (KINesin)

Aliases

PreTt11898 | 1.m00946

Description

Kinesin-like protein; contains a C-terminal motor domain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00014920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02660.19.997093137033517e-262kinesin motor domain-containin
g protein (1596 aa)
OxytrichaContig11028.0.g321.0002646133906571e-103Kinesin motor domain
DictyBaseDDB_G02673961.0001267035975107e-72kif2 on chromosome: 1 position
351991 to 354465
WormBaseWBGene000022303.0012565309061457e-65locus:klp-20 status:Confirme
d UniProt:Q965T6 protein_i
d:CCD73793.1
SGDYPR141C4.997966074691795e-65KAR3 Minus-end-directed microt
ubule motor that functions in
mitosis and meiosis, localizes
to the spindle pole body and
localization is dependent on f
unctional Cik1p, required for
nuclear fusion during mating;
potential Cdc28p substrate
Stentor CoeruleusSteCoe_210121.6889118802245324e-48

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00014920(coding)
ATGAATTTAAATTTAAATTTTCTGGGAAACGATATGGCTGACAATTAGATTCCCACTATT
CCAATTTAACAGCAATAGCAAAATTAATAGCACTCAAATCATATGTTCAATTAGCTTTCA
CACCCAAGCAATTAAAATTTTCATGAGTAATATTAAAACTACAGTCCAGGCAATCATCAG
TCTTTTAATATAATTGATTCAGAGGATCCTATGCCAATGGACTAATTTTTATCGCAGCAA
CACAACTCGAGCAGCTCATAAATTAGTTAGTCTGAGAGTAGTGAACATGAATTATCAACT
GATAGTCTTATTTAAAGTTTATAGGAAGGATTGATGTTAGCCTCTAAATCTGCAGTGGAT
TATTCTATGAATTATTCCAATAGTTTAGGTGGAAGAACACATTCCTTGACATAAAAAAAT
AATTGCCTCACTACAAAGACCTTTAACAAGCAGTTGCAGAGCCATCAAGTAACGAATGAA
GACGAAATTACTTATTTAAATAAGAGAAGCTAATATGTTTTAGATTAATTAGCTGAAATA
GCTGAAGAGTAAGAGAATACTTTTCAAAATTTATAAGAAAGGAACTTGTAGTATTTAAAG
CAGATAGCATTTGAAAAAATAGAATTGTATAAAGTAGAGTTTAGTAAGGTATTATAAGAA
TGTGAATAGTATCGTTAAGAGTCTCAGGATATCAAAGAGAAATTTGATGAGCATTTGCTA
TCATGCGAAGGTGCTTAGCCAAATAGAGAGGAAGAGTTTAATGTATTAATGTCAAATTTA
TAAAAAAAGGAAGAGGAGATTGAATTTGTGAAAAAGCATATCGAAGTTAAATATTCGTTA
GATTTTATCATAGAAAATGTAGAAAAGGAATTTATTAGAAAATAATTTAGTGAGGAAATA
TAAAGGCTAGAGGAAATTAATTTAGAATTAGAGAACAAATGTGAAATATTTTTGGAGGAA
AAAAAGCTCTCGGAAAATAAATTTAATTAGGAATTGACTGTTTTAAAGCTGAAAATAGAG
GATTTAGAGAAAATAAACTAGAAAAAATCTGAAGAAAATGTTTAAATTTTAAGTGAATTC
GATAATTGTAAATAAGAACTTATCAAAGCTGAGTCTGAGATAGAAAGGATAAAATAAACA
TCTTTAGAATTGAATTCTAAAATATCTAGTTTGGAAAGTACAAATAGCTTGCTAAATGCC
CAAATTGAAAAAATAGCTAAATAGCTTAAGGAAAAGGAATCAATTATAACACAATTTGAT
AAGGATCGTCTCGATTAAACGAATTTGTTATAAAAATTATAAGAGGAATTAGCTTTGAAA
AATGACACTTTGGAGAGATTCCAGGTAAAATCTGATGATCTAAATCAAAATAATAAAAAT
TAATCTCAGTATTTAAATGGAGAACACAATCAACATAAAACAGATACAATTAAATATGAA
GAAGAAGTAAATAAGCTTAAACTTGAGTTAGAAGATAAAAACAATTAAATCAAAAAGCTA
AAGCAAACTATTTTGATAAAAGATAGAATGCAAAAGTAAACTCTTAATGGATCACTAACT
GGTTCAGGCATTAAGAAATCTCAAACTCCTACTCTTCTTAATCACCAAACTTCTGTTAAT
GATCAAAGTCTGCTATCAACTATAAACAACAACCACAATCAATCATTTTAACATTAAGAC
ACACAAAAGATTTCATCAAAGGAAATTTAAGAGTAATGCCTAAATAGTGTATAAAAAAAT
TAAACAGACAAAGAATTATGCAGTGACGAAATGTCAAAGAGAAAAGCATTAAAAAAGATA
GTTGGAGACGAAAGTATTTAAGATTAAAGCAAACACCAATACTTAATGCAAGAATAAAAT
AAGACTGGATAAGAGCAATTTGAAAATGAAAAAATCACTACCTAAGTAAGTTAAAGAGGA
AACAATCATGAGGTTACCTAGATAAGCAATATAGATGGAAACACTCAAGACGTAAATGAT
ATTTCAGATATGATCATATGCAATACAAATCATTAAAGACTACAAAAAAAGAAGCACAAA
AGCATAGATAGCACTTAGAGAGAAAGTTTAGGGAAAAAATTATTAATAAATCACTCATTT
AAGAATGGATTCTTAACTTAAAAGCAAAGCATAATTAATGATGGACAATGCAATCAAAGC
CTTAATATAAACGACACTATTGTAAATAATGGATCTATGATGCTCTCTATGCAATAATCC
AATATCATGCAATAAGAAGAAGTCAATTAGTCTCAATAGCAAATGGATACCCAAATAACA
TCCAAGGCCAGAAGAGCCCAAAGTATGAACTCAGAGTCCTTCAGCTAAATGTTTAACCAA
GATGAAAATACTTTCAAAGAATTGAAGGTCAATTTGAGAAAAAAGAGAGAAAAACAAGAA
GAGTTAAAGCTTATTCTTGAAAATTTCAAAAAAGAATTTAAACAAACTAACCAAAGAGAT
CCTGTTGGCAAAGACTGGTAACCATACAGCAGCGTACTGACTGAATATAAAAATTTAAAA
AATGAAATCTTAGAAATCAGATAAAAGTTGATAGATATCAAGGATAAAAAAGATTCAAAC
ATGAGCATTAGTCACTTGGCTGATTATTCTATGATTAAGAACACTGATGATTCTAGATGT
GCTGATAATTCAATGATAAATAATCTTTCAATAATAAGAGCTACTGCTCCTCATTAAAAG
CTCATTTAATACAAATAAAAACAAATCCTCAATTAAAGTCACATGAGCCAAAACTCATTC
TACATAGATTAAAATTAAACTTCATTAAATTCCATTTCCGTTTAGCTTGGTGATTACCAA
GGATTCGTCTCTACAGCAGCTTCCCATTCATCTAAATAAGCTGAGGGTGAGTTCAACAAA
GGTCTGCGTTTGTAAGTTTCTAATCTAGAAGAAGCAAATAAGCTACTCAAAGACCAAGTA
TTTAAGTCACTTGAATATGAAAAGGAATTAAGAAATAAAGGCGAAACAATTGAGCAACTT
TAAAATGAAATAAAAGATATTACAAAGAAGAAAGATGAAGAAATTAAAGAATTGAAGGAC
ACTGTTGATATACTCACTAATAAGCTTGATGAAGAAACTAAAGAGAGAAAAATTTTGCAT
AACATAGTAGAAGATATGAAGGGTAAAATTAGAGTTTTTTGTAGAGTAAGACCTCCCAAT
GAGAATGAAGTCCAGATGAACTCTCAAAATGTCGTTGAAGTTTTAGACGCTATGAACTGC
AAACTCTAAGCAAAAAATGGTCCTAAGAAATTTTAATTCGATTCTTGTTTTGGATTCAGC
TCACGCTAGGATGATATTTTCAATGATGCTAAAAAGTTGATTCAAAGTGCTGTTGATGGT
TATAATGTTTGTATTTTCGCTTACGGACAAACAGGTTCAGGTAAATCCTTTACTATGTAA
GGAACTAGAGAAATGCCAGGTATTACACCTAGATCAGTAAACGAACTGTTTAATCTCTTG
AAACCAATCTAAAAGACTTGCAAAGTAACCATCTCTGCATATATTATGGAATTATATATG
GACAATCTGATTGATTTACTAGCTCCACCTAATTCTATAATGCAAAAAAAACTAGAAATA
AAAGAAGATTACATAACTAATACTACATATGTCCAAAACGCAACAATAGCTGAAGTTACC
AAGAAAGAAGAATTAGAATAAATTATTTAGAAAGGAATTCTCAATAGAAAAATCAGCAAG
ACAGATATGAATGTTGAATCTTCCAGATCACATTTGATTATCACAATATTAATTAACATA
TTCAATCCTTAAACAGAAACTACAACTCATGGTAAAATTAGTCTGATTGATTTGGCAGGC
AGTGAAAGAATTCTGAAATCTGGAGCTAATCCTCATCAAGTTAAAGAAGCTAATTCGATT
AATAAAAGTTTAACTGCCTTAGGAGACGTCATTTCAGCTTTAACAAACTAGCAGTAAAAC
GGAGGAGAAAGACATATCCCTTACAGAAATAACAAGCTTACATATTTAATGAAAGATTCT
CTTGGAGGAAATGCAAAAACTTTGATGATTGTTAATGTAAGTCCAAGCGAATACAATTTA
GAAGAAACAAACAGTAGCTTGTAATATGCCAGTAGAGTAAAGACTATTGTAAATGAAACA
AGCAAAAATATAGAAACAAAGGACTACACAAGACTTAAAGAAAAATTTTAATAAATCCTA
TAAGAAAATGAGAAACTCCAAGAGCTCATTTCTGATTAAAATAGAAATCCTAACCAACAA
TCAAGCCAACCAAATCTCTCAGTTATTTAATAAGTTCCACAATAACAAATTCAACCTAAT
AAATAAACATAAATTTACTCTTTCGGTTAGTAAAAGCCTTCATTAGCAGAAGACTAAATC
TCAAGTTAATTAAATTAATAGCAAATTCCAATTATATCCTAATAGTAGTAAAAGCTAGCG
CCTATTTAGCCACATTAACAATAAGCACAAAAACCAAGCTTATTGGCAAGTGGTAGAAAT
TCTAACAACTCCTCACAAAATCAACAATAAATAAATTAAATTCTTTACAACTAGTAACAG
CAGTAGTAATAACAATAACAAATTTCTTCTTAACATAAAAGAAGTAATTCTCCTTTGATT
GTTAATTAGAATCAATAGGGCTAATAATAAAATGTATTTTCTGCTCCTCATATCCAATTG
ACTTCATAGTAATTATATGGTAGTATGAAAAGTTCTTCAGTAACTCCACTTTAAAACAAC
ATTAATATTAATAATATCTAGAAAGTAAATTAACAGCAATAATAATTATAAAACTAGCTA
AATAGAATTAATTGA


>TTHERM_00014920(protein)
MNLNLNFLGNDMADNQIPTIPIQQQQQNQQHSNHMFNQLSHPSNQNFHEQYQNYSPGNHQ
SFNIIDSEDPMPMDQFLSQQHNSSSSQISQSESSEHELSTDSLIQSLQEGLMLASKSAVD
YSMNYSNSLGGRTHSLTQKNNCLTTKTFNKQLQSHQVTNEDEITYLNKRSQYVLDQLAEI
AEEQENTFQNLQERNLQYLKQIAFEKIELYKVEFSKVLQECEQYRQESQDIKEKFDEHLL
SCEGAQPNREEEFNVLMSNLQKKEEEIEFVKKHIEVKYSLDFIIENVEKEFIRKQFSEEI
QRLEEINLELENKCEIFLEEKKLSENKFNQELTVLKLKIEDLEKINQKKSEENVQILSEF
DNCKQELIKAESEIERIKQTSLELNSKISSLESTNSLLNAQIEKIAKQLKEKESIITQFD
KDRLDQTNLLQKLQEELALKNDTLERFQVKSDDLNQNNKNQSQYLNGEHNQHKTDTIKYE
EEVNKLKLELEDKNNQIKKLKQTILIKDRMQKQTLNGSLTGSGIKKSQTPTLLNHQTSVN
DQSLLSTINNNHNQSFQHQDTQKISSKEIQEQCLNSVQKNQTDKELCSDEMSKRKALKKI
VGDESIQDQSKHQYLMQEQNKTGQEQFENEKITTQVSQRGNNHEVTQISNIDGNTQDVND
ISDMIICNTNHQRLQKKKHKSIDSTQRESLGKKLLINHSFKNGFLTQKQSIINDGQCNQS
LNINDTIVNNGSMMLSMQQSNIMQQEEVNQSQQQMDTQITSKARRAQSMNSESFSQMFNQ
DENTFKELKVNLRKKREKQEELKLILENFKKEFKQTNQRDPVGKDWQPYSSVLTEYKNLK
NEILEIRQKLIDIKDKKDSNMSISHLADYSMIKNTDDSRCADNSMINNLSIIRATAPHQK
LIQYKQKQILNQSHMSQNSFYIDQNQTSLNSISVQLGDYQGFVSTAASHSSKQAEGEFNK
GLRLQVSNLEEANKLLKDQVFKSLEYEKELRNKGETIEQLQNEIKDITKKKDEEIKELKD
TVDILTNKLDEETKERKILHNIVEDMKGKIRVFCRVRPPNENEVQMNSQNVVEVLDAMNC
KLQAKNGPKKFQFDSCFGFSSRQDDIFNDAKKLIQSAVDGYNVCIFAYGQTGSGKSFTMQ
GTREMPGITPRSVNELFNLLKPIQKTCKVTISAYIMELYMDNLIDLLAPPNSIMQKKLEI
KEDYITNTTYVQNATIAEVTKKEELEQIIQKGILNRKISKTDMNVESSRSHLIITILINI
FNPQTETTTHGKISLIDLAGSERILKSGANPHQVKEANSINKSLTALGDVISALTNQQQN
GGERHIPYRNNKLTYLMKDSLGGNAKTLMIVNVSPSEYNLEETNSSLQYASRVKTIVNET
SKNIETKDYTRLKEKFQQILQENEKLQELISDQNRNPNQQSSQPNLSVIQQVPQQQIQPN
KQTQIYSFGQQKPSLAEDQISSQLNQQQIPIISQQQQKLAPIQPHQQQAQKPSLLASGRN
SNNSSQNQQQINQILYNQQQQQQQQQQISSQHKRSNSPLIVNQNQQGQQQNVFSAPHIQL
TSQQLYGSMKSSSVTPLQNNININNIQKVNQQQQQLQNQLNRIN


>TTHERM_00014920(gene)
ATGAATTTAAATTTAAATTTTCTGGGAAACGATATGGCTGACAATTAGATTCCCACTATT
CCAATTTAACAGCAATAGCAAAATTAATAGCACTCAAATCATATGTTCAATTAGCTTTCA
CACCCAAGCAATTAAAATTTTCATGAGTAATATTAAAACTACAGTCCAGGCAATCATCAG
TCTTTTAATATAATTGATTCAGAGGATCCTATGCCAATGGACTAATTTTTATCGCAGCAA
CACAACTCGAGCAGCTCATAAATTAGTTAGTCTGAGAGTAGTGAACATGAATTATCAACT
GATAGTCTTATTTAAAGTTTATAGGAAGGATTGATGTTAGCCTCTAAATCTGCAGTGGAT
TATTCTATGAATTATTCCAATAGTTTAGGTGGAAGAACACATTCCTTGACATAAAAAAAT
AATTGCCTCACTACAAAGACCTTTAACAAGCAGGTAATTTGTCAAAAAACTTTAGTATTA
AAAGTAAATTGCAGTGGTAGTTTGATAATTGTTTTTCAATAAGGAAAAAAAGTGTTTTTT
TTTAGAAAACTCAACAAAATAATTGAGAGAGCAAAGAAGCAATTGAATTAAAATGATTTT
GTTTTAAAATTCTTTTATATTTAAAGTTGCAGAGCCATCAAGTAACGAATGAAGACGAAA
TTACTTATTTAAATAAGAGAAGCTAATATGTTTTAGATTAATTAGCTGAAATAGCTGAAG
AGTAAGAGAATACTTTTCAAAATTTATAAGAAAGGAACTTGTAGTATTTAAAGCAGATAG
CATTTGAAAAAATAGAATTGTATAAAGTAGAGTTTAGTAAGGTATTATAAGAATGTGAAT
AGTATCGTTAAGAGTCTCAGGATATCAAAGAGAAATTTGATGAGCATTTGCTATCATGCG
AAGGTGCTTAGCCAAATAGAGAGGAAGAGTTTAATGTATTAATGTCAAATTTATAAAAAA
AGGAAGAGGTAATGATATAAAAATGTTTTAAATTTAAAGCAAGGCGAATTATAAATATGC
AGAAACATAATCTAGCTTATAAACTTACAAAGAAACAACAACTAAATAATAAATATAAAA
CAAGCAAGCAAAAAAAATAAAATTAAACGATCAAAAATTTAAAAGAAATATTGAAATTCA
AAATAATTTTGAATTTAGAGAAGTTTTTCAGATTAAATTTGAATTAATTGATTTTAAACG
GTTTAGGATTAATGAAAAATATTTTATTTTTTAATATTAGGAGATTGAATTTGTGAAAAA
GCATATCGAAGTTAAATATTCGTTAGATTTTATCATAGAAAATGTAGAAAAGGAATTTAT
TAGAAAATAATTTAGTGAGGAAATATAAAGGCTAGAGGAAATTAATTTAGAATTAGAGAA
CAAATGTGAAATATTTTTGGAGGAAAAAAAGCTCTCGGAAAATAAATTTAATTAGGAATT
GACTGTTTTAAAGCTGAAAATAGAGGATTTAGAGAAAATAAACTAGAAAAAATCTGAAGA
AAATGTTTAAATTTTAAGTGAATTCGATAATTGTAAATAAGAACTTATCAAAGCTGAGTC
TGAGATAGAAAGGATAAAATAAACATCTTTAGAATTGAATTCTAAAATATCTAGTTTGGA
AAGTACAAATAGCTTGCTAAATGCCCAAATTGAAAAAATAGCTAAATAGCTTAAGGAAAA
GGAATCAATTATAACACAATTTGATAAGGATCGTCTCGATTAAACGAATTTGTTATAAAA
ATTATAAGAGGAATTAGCTTTGAAAAATGACACTTTGGAGAGATTCCAGGTAAAATCTGA
TGATCTAAATCAAAATAATAAAAATTAATCTCAGTATTTAAATGGAGAACACAATCAACA
TAAAACAGATACAATTAAATATGAAGAAGAAGTAAATAAGCTTAAACTTGAGTTAGAAGA
TAAAAACAATTAAATCAAAAAGCTAAAGCAAACTATTTTGATAAAAGATAGAATGCAAAA
GTAAACTCTTAATGGATCACTAACTGGTTCAGGCATTAAGAAATCTCAAACTCCTACTCT
TCTTAATCACCAAACTTCTGTTAATGATCAAAGTCTGCTATCAACTATAAACAACAACCA
CAATCAATCATTTTAACATTAAGACACACAAAAGATTTCATCAAAGGAAATTTAAGAGTA
ATGCCTAAATAGTGTATAAAAAAATTAAACAGACAAAGAATTATGCAGTGACGAAATGTC
AAAGAGAAAAGCATTAAAAAAGATAGTTGGAGACGAAAGTATTTAAGATTAAAGCAAACA
CCAATACTTAATGCAAGAATAAAATAAGACTGGATAAGAGCAATTTGAAAATGAAAAAAT
CACTACCTAAGTAAGTTAAAGAGGAAACAATCATGAGGTTACCTAGATAAGCAATATAGA
TGGAAACACTCAAGACGTAAATGATATTTCAGATATGATCATATGCAATACAAATCATTA
AAGACTACAAAAAAAGAAGCACAAAAGCATAGATAGCACTTAGAGAGAAAGTTTAGGGAA
AAAATTATTAATAAATCACTCATTTAAGAATGGATTCTTAACTTAAAAGCAAAGCATAAT
TAATGATGGACAATGCAATCAAAGCCTTAATATAAACGACACTATTGTAAATAATGGATC
TATGATGCTCTCTATGCAATAATCCAATATCATGCAATAAGAAGAAGTCAATTAGTCTCA
ATAGCAAATGGATACCCAAATAACATCCAAGGCCAGAAGAGCCCAAAGTATGAACTCAGA
GTCCTTCAGCTAAATGTTTAACCAAGATGAAAATACTTTCAAAGAATTGAAGGTCAATTT
GAGAAAAAAGAGAGAAAAACAAGAAGAGTTAAAGCTTATTCTTGAAAATTTCAAAAAAGA
ATTTAAACAAACTAACCAAAGAGATCCTGTTGGCAAAGACTGGTAACCATACAGCAGCGT
ACTGACTGAATATAAAAATTTAAAAAATGAAATCTTAGAAATCAGATAAAAGTTGATAGA
TATCAAGGATAAAAAAGATTCAAACATGAGCATTAGTCACTTGGCTGATTATTCTATGAT
TAAGAACACTGATGATTCTAGATGTGCTGATAATTCAATGATAAATAATCTTTCAATAAT
AAGAGCTACTGCTCCTCATTAAAAGCTCATTTAATACAAATAAAAACAAATCCTCAATTA
AAGTCACATGAGCCAAAACTCATTCTACATAGATTAAAATTAAACTTCATTAAATTCCAT
TTCCGTTTAGCTTGGTGATTACCAAGGATTCGTCTCTACAGCAGCTTCCCATTCATCTAA
ATAAGCTGAGGGTGAGTTCAACAAAGGTCTGCGTTTGTAAGTTTCTAATCTAGAAGAAGC
AAATAAGCTACTCAAAGACCAAGTATTTAAGTCACTTGAATATGAAAAGGTATTTTTGTT
TTATTTATTTTTTGGCTTTATTTTTCTCTAAAAAAGAAAAAAAACATTTGTTTTGTTATT
TTAAATTTAAATTTAATTTTTTAATAAATAGGAATTAAGAAATAAAGGCGAAACAATTGA
GCAACTTTAAAATGAAATAAAAGATATTACAAAGAAGAAAGATGAAGAAATTAAAGAATT
GAAGGACACTGTTGATATACTCACTAATAAGCTTGATGAAGAAACTAAAGAGAGAAAAAT
TTTGCATAACATAGTAGAAGATATGAAGGGTAAAATTAGAGTTTTTTGTAGAGTAAGACC
TCCCAATGAGAATGAAGTCCAGATGAACTCTCAAAATGTCGTTGAAGTTTTAGACGCTAT
GAACTGCAAACTCTAAGCAAAAAATGGTCCTAAGAAATTTTAATTCGATTCTTGTTTTGG
ATTCAGTAAAAAAATTAAAATTTATTTTTAAACAAGCAATTTCATTTGTTTTTTTTTTAA
AATTTATTTAAAAATTTAATTCAAATGAAATTGAAATAAATTCAATTAAATTTAAATTAA
AGGCTCACGCTAGGATGATATTTTCAATGATGCTAAAAAGTTGATTCAAAGTGCTGTTGA
TGGTTATAATGTTTGTATTTTCGCTTACGGACAAACAGGTTCAGGTAAATCCTTTACTAT
GTAAGGAACTAGAGAAATGCCAGGTATTACACCTAGATCAGTAAACGAACTGTTTAATCT
CTTGAAACCAATCTAAAAGACTTGCAAAGTAACCATCTCTGCATATATTATGGAATTATA
TATGGACAATCTGATTGATTTACTAGCTCCACCTAATTCTATAATGCAAAAAAAACTAGA
AATAAAAGAAGATTACATAACTAATACTACATATGTCCAAAACGCAACAGTATTCTTTCT
TTAAATAATTTAGATGCAAAGTTAACTTTTTTATTTAATAAAAACAGATAGCTGAAGTTA
CCAAGAAAGAAGAATTAGAATAAATTATTTAGAAAGGAATTCTCAATAGAAAAATCAGCA
AGACAGATATGAATGTTGAATCTTCCAGATCACATTTGATTATCACAATATTAATTAACA
TATTCAATCCTTAAACAGAAACTGTAATGATTTATTTTTTTAATATTTAAGCATTTATTA
AAAAATAAAATCATTTTAGACAACTCATGGTAAAATTAGTCTGATTGATTTGGCAGGCAG
TGAAAGAATTCTGAAATCTGGAGCTAATCCTCATCAAGTTAAAGAAGCTAATTCGATTAA
TAAAAGTTTAACTGCCTTAGGAGACGTCATTTCAGCTTTAACAAACTAGCAGTAAAACGG
AGGAGAAAGACATATCCCTTACAGAAATAACAAGCTTACATATTTAATGAAAGATTCTCT
TGGAGGAAATGTAAATAAATAATTACAATTTATTCAAATTTTTTTTCTTAATAAAATGTA
AAATTTTAGGCAAAAACTTTGATGATTGTTAATGTAAGTCCAAGCGAATACAATTTAGAA
GAAACAAACAGTAGCTTGTAATATGCCAGTAGAGTAAAGACTATTGTAAATGAAACAAGC
AAAAATATAGAAACAAAGGACTACACAAGACTTAAAGAAAAATTTTAATAAATCCTATAA
GAAAATGAGAAACTCCAAGAGCTCATTTCTGATTAAAATAGAAATCCTAACCAACAATCA
AGCCAACCAAATCTCTCAGTTATTTAATAAGTTCCACAATAACAAATTCAACCTAATAAA
TAAACATAAATTTACTCTTTCGGTTAGTAAAAGCCTTCATTAGCAGAAGACTAAATCTCA
AGTTAATTAAATTAATAGCAAATTCCAATTATATCCTAATAGTAGTAAAAGCTAGCGCCT
ATTTAGCCACATTAACAATAAGCACAAAAACCAAGCTTATTGGCAAGTGGTAGAAATTCT
AACAACTCCTCACAAAATCAACAATAAATAAATTAAATTCTTTACAACTAGTAACAGCAG
TAGTAATAACAATAACAAATTTCTTCTTAACATAAAAGAAGTAATTCTCCTTTGATTGTT
AATTAGAATCAATAGGGCTAATAATAAAATGTATTTTCTGCTCCTCATATCCAATTGACT
TCATAGTAATTATATGGTAGTATGAAAAGTTCTTCAGTAACTCCACTTTAAAACAACATT
AATATTAATAATATCTAGAAAGTAAATTAACAGCAATAATAATTATAAAACTAGCTAAAT
AGAATTAATTGA