Identifiers and Description

Gene Model Identifier

TTHERM_00219585

Standard Name

KIN7 (KINesin)

Aliases

3701.m01498

Description

kinesin heavy chain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF07197 ) Protein of unknown function (DUF1409)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00219585

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_125640
Tetrahymena borealisEI9_06744.19.997093137033517e-262kinesin heavy chain (1015 aa)
OxytrichaContig22693.0.g409.997093137033517e-262Kinesin motor domain
DictyBaseDDB_G02931983.9988176960464313e-94kif10 on chromosome: 6 positio
n 2654607 to 2658323
SGDYGL216W9.996584278131743e-91KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning
WormBaseWBGene000022246.0018831389078936e-89locus:klp-13 status:Partiall
y_confirmed UniProt:H2KYL6
protein_id:CCD63819.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219585(protein)
MEQEKQNVNSSNSPEPANVENKNQGEQQQPQQQQQNQQVIKQQVPAVIANIEKKVPEMES
NILVAIRVRPLNIKEENQGDWDIIRIEDQLIIVLDPVEMEFASENRKMLEVYHRSKEQRY
AFDKIFRLHSQEEVYSQTCRHLIKPVIQGFNATVFAYGPTGTGKTYTMLGNQDTPGLCTL
TIQDIFQFIKKDSDNEYQVTITYVEIYNETIRDLLVPHSTYLELRDDPLKGITIAGVTES
KAESVEQVMNLLFLGNKRRTTEATNANQTSSRSHAVFQVTVNSRSRTKNTEQENLQGKLS
LIDLAGSERGTVTENRGIRLREGAKINQSLLALANCINALGDKSKKGFFVPYRDSKLTRM
LKDSLGGNCKTVMIANVSPSSAQFEETINTLKYANRAKNIKTKVQANKRLVSMHIAEYKN
IINDLRSEIEQLKAKLHDKIGDNNDILNYQEEEQQYLEKQHLNQLPNVISGNCICGRQED
EQNMRKIQEEIFENFQNRIQLRRGLMEVEEQNAMNILEIKKKQAEILVWKKSAQYQGSQE
NNIEDLNIDDSLSNNQQQQKEPKKKIPEEIKQLVKAVRTLKVATEKNTIRKEMMTLSLLE
NIANAKLIRDRIPKKIKHQDKRNYLELVIKNHVLELQNIEMEINLQIQEKTIQDLKNIIE
SQRKIINENNINSQANGLLNEEENNILSNYSQDDIDIEFQDIVDEDDLNEDKDNQDDDEE
DMNDITDLQEMIQKQKELSSPMNNNAANNQNQDDFNMYEKPNKRDDLDKNGNKRGSSRTD
VLPEINQNKRDKSAAGYNNKHSSKSSQDNMIKNQFNDNEINKETLNEIDENNNEGFNSTP
KMVQGNLKGEKKKEQIDQKKKNHNKQQNPKKKEGTSAIPNNVQISIQGQAAIQNSKESGS
LNIIQSNQGGGINNISNNVNSMSNINSQLNGNNININNNNNNNNKGMPQIGKQNNQQPQK
DKDFSGLNLKGKNIILPALNSNNNNQSNINNNNNNNPSSNPNIPNNNFLKDANAQNRKKR


>TTHERM_00219585(coding)
ATGGAGTAGGAAAAATAAAACGTTAATAGCTCTAATTCCCCGGAACCAGCTAATGTTGAG
AACAAAAATTAAGGTGAGCAGTAGCAGCCTTAGCAGTAATAACAGAATTAGTAAGTTATA
AAATAATAGGTACCTGCTGTAATTGCAAATATTGAAAAGAAAGTTCCTGAAATGGAATCT
AATATTTTGGTTGCAATTAGGGTAAGGCCTTTGAATATAAAAGAGGAAAATCAAGGAGAT
TGGGATATTATTCGTATAGAGGATTAGCTAATCATTGTTTTAGATCCAGTTGAAATGGAG
TTTGCAAGCGAGAATAGGAAAATGTTGGAAGTTTATCACCGTTCTAAAGAGCAGAGATAT
GCATTCGATAAGATTTTTAGATTGCATAGTTAAGAGGAAGTTTATTCATAAACATGTCGT
CATTTAATCAAGCCAGTTATTCAAGGATTTAATGCTACTGTATTTGCTTACGGTCCAACA
GGAACTGGTAAAACTTATACTATGCTTGGTAATTAAGACACACCTGGTTTATGCACACTC
ACAATTCAAGATATTTTTCAATTCATCAAAAAAGATTCTGATAATGAATATCAAGTAACC
ATTACTTACGTAGAAATTTATAATGAAACAATTAGAGATTTGCTTGTTCCTCATTCAACA
TATTTAGAACTTAGAGATGACCCATTAAAGGGTATAACTATTGCTGGTGTTACTGAATCT
AAAGCCGAGTCAGTTGAATAAGTCATGAATTTACTCTTTTTGGGTAACAAGAGAAGAACA
ACAGAGGCAACAAATGCAAACTAAACTTCCTCTAGAAGCCATGCTGTTTTCTAAGTTACA
GTTAATTCTAGATCCAGAACTAAAAATACAGAGTAAGAAAATTTGTAAGGAAAGCTTTCT
TTGATTGATTTAGCTGGCTCAGAAAGAGGAACTGTTACAGAAAACAGAGGTATCCGTCTG
AGAGAAGGTGCTAAAATTAATTAATCTCTCTTAGCTTTAGCAAATTGTATTAATGCTTTA
GGTGATAAATCAAAAAAAGGATTTTTTGTTCCTTATAGAGACTCAAAATTGACAAGAATG
CTTAAAGACAGTCTGGGAGGAAATTGCAAAACAGTTATGATTGCAAACGTAAGTCCTAGT
AGTGCTTAATTCGAAGAAACAATTAACACTTTGAAATATGCAAATAGAGCAAAAAATATA
AAAACAAAAGTCTAAGCAAATAAGAGATTAGTCTCTATGCATATAGCTGAGTATAAAAAT
ATTATAAATGACCTACGCTCTGAAATAGAATAGCTCAAAGCTAAGCTTCATGATAAAATT
GGAGATAATAATGACATTCTGAATTATTAAGAAGAGGAGCAGTAATATTTAGAAAAGTAG
CATTTGAACTAACTTCCAAATGTTATTTCTGGTAACTGCATTTGTGGTAGATAAGAAGAT
GAGTAAAACATGAGAAAAATTCAAGAAGAAATATTTGAAAATTTTTAGAATAGAATATAA
CTTCGTAGAGGTCTAATGGAAGTAGAAGAATAAAATGCTATGAATATCCTTGAGATTAAA
AAAAAATAAGCAGAAATACTAGTTTGGAAGAAATCTGCATAATATTAGGGAAGCTAAGAA
AATAACATTGAGGATTTAAATATAGATGACAGTTTATCTAATAATTAATAACAACAAAAG
GAACCTAAAAAAAAAATACCTGAAGAAATCAAATAACTAGTTAAGGCAGTTAGAACTTTA
AAAGTTGCAACTGAGAAGAACACAATTAGAAAAGAAATGATGACGTTAAGCTTATTAGAA
AATATTGCTAATGCGAAGTTGATTCGTGATAGAATTCCAAAAAAAATTAAACATCAAGAT
AAAAGGAACTATCTAGAACTTGTTATTAAAAATCATGTTTTAGAGCTGTAAAATATTGAA
ATGGAAATAAACTTGCAGATCTAGGAAAAGACCATTTAAGATTTAAAAAACATCATAGAG
TCTTAAAGAAAAATAATAAATGAAAATAATATTAACAGTCAAGCTAATGGCCTATTAAAC
GAAGAAGAAAACAATATTTTAAGTAATTATTCTTAAGATGACATAGACATAGAATTTTAA
GACATAGTCGATGAAGATGATCTAAATGAAGATAAAGATAATTAAGATGATGATGAAGAG
GATATGAATGACATAACCGATCTCTAAGAAATGATATAAAAATAAAAAGAATTAAGTTCT
CCTATGAATAACAATGCTGCCAACAATTAAAATTAGGATGACTTTAATATGTATGAAAAG
CCTAACAAGAGAGATGATTTAGATAAAAATGGTAACAAAAGAGGCTCATCTAGAACTGAT
GTGCTTCCTGAGATAAACCAAAATAAAAGAGATAAATCTGCTGCTGGTTATAATAATAAA
CACTCATCGAAATCCTCCTAAGATAATATGATCAAGAATTAATTTAACGATAATGAAATT
AATAAGGAAACTCTGAATGAGATTGATGAAAATAATAATGAAGGCTTCAATAGCACTCCT
AAAATGGTCTAAGGCAATTTGAAGGGGGAAAAAAAGAAAGAGTAAATTGACCAAAAGAAA
AAGAATCATAATAAATAATAGAATCCAAAAAAGAAAGAAGGAACCTCAGCTATCCCTAAT
AATGTGTAAATAAGTATTTAAGGTTAAGCTGCAATTTAAAATTCAAAAGAAAGTGGAAGC
TTAAATATTATTTAAAGCAATTAAGGTGGTGGTATAAATAATATTTCTAATAATGTGAAT
AGTATGAGTAATATAAACAGTTAGCTAAATGGGAATAATATAAACATCAATAATAATAAT
AATAACAATAATAAGGGTATGCCCTAAATCGGAAAATAAAATAATTAATAGCCATAAAAA
GACAAAGATTTTTCTGGCCTAAATTTAAAAGGAAAAAATATAATATTGCCTGCATTAAAT
AGTAATAACAATAATTAGAGTAACATCAATAACAATAATAATAATAATCCATCTTCTAAT
CCTAATATACCAAATAACAATTTTCTTAAAGACGCTAATGCATAAAATCGTAAAAAGCGT
TGA


>TTHERM_00219585(gene)
ATGGAGTAGGAAAAATAAAACGTTAATAGCTCTAATTCCCCGGAACCAGCTAATGTTGAG
AACAAAAATTAAGGTGAGCAGTAGCAGCCTTAGCAGTAATAACAGAATTAGTAAGTTATA
AAATAATAGGTACCTGCTGTAATTGCAAATATTGAAAAGAAAGTTCCTGAAATGGAATCT
AATATTTTGGTTGCAATTAGGGTAAGGCCTTTGAATATAAAAGAGGAAAATCAAGGAGAT
TGGGATATTATTCGTATAGAGGATTAGCTAATCGTAAAAACTATTTCTGTCAGCTACAAT
TTTCTGTTAACATATTTTTTAAGATTGTTTTAGATCCAGTTGAAATGGAGTTTGCAAGCG
AGAATAGGAAAATGTTGGAAGTTTATCACCGTTCTAAAGAGCAGAGATATGCATTCGATA
AGATTTTTAGATTGCATAGTTAAGAGGAAGTAATTAATTATTTGAAATTTAATCTAAAAT
TAAATATTTACATAAATTTAAAGGTTTATTCATAAACATGTCGTCATTTAATCAAGCCAG
TTATTCAAGGATTTAATGCTACTGTATTTGCTTACGGTCCAACAGTAATTTATCTAATAA
ATATTTAAGCATTTCAATTATTTTTATAAAAAATTGTGTTATTATTAAAGTATTTTTACT
AATTCTTAATTTTAAATCATTTTAATGATTATAAATTGTTTAGGGAACTGGTAAAACTTA
TACTATGCTTGGTAATTAAGACACACCTGGTTTATGCACACTCACAATTCAAGATATTTT
TCAATTCATCAAAAAAGATTCTGATAATGAATATCAAGTAACCATTACTTACGTAGAAAT
TTATAATGAAACAATTAGAGATTTGCTTGTTCCTCATTCAACATATTTAGAACTTAGAGA
TGACCCATTAAAGGTAAATTTAAATTAAAAGTCTTTAAATATATTCTTATTTATAATAAC
AAGGGTATAACTATTGCTGGTGTTACTGAATCTAAAGCCGAGTCAGTTGAATAAGTATAT
CAAATACATTTTTATAAAAATTTTATAGTTAAAACTGCTATTTAAAGGTCATGAATTTAC
TCTTTTTGGGTAACAAGAGAAGAACAACAGAGGCAACAAATGCAAACTAAACTTCCTCTA
GAAGCCATGCTGTTTTCTAAGTTACAGTTAATTCTAGATCCAGAACTAAAAATACAGAGT
AAGAAAATTTGTAAGGAAAGCTTTCTTTGATTGATTTAGCTGGCTCAGAAAGAGGAACTG
TTACAGAAAACAGAGGTATCCGTCTGAGAGAAGGTGCTAAAATTAATTAATCTCTCTTAG
CTTTAGCAAATTGTATTAATGCTTTAGGTGATAAATCAAAAAAAGGATTTTTTGTTCCTT
ATAGAGACTCAAAATTGACAAGAATGCTTAAAGTATATTTTTATATTTAAATTTAGAAGT
ATTTGATGTGTAAATACAAATTAATAGGACAGTCTGGGAGGAAATTGCAAAACAGTTATG
ATTGCAAACGTAAGTCCTAGTAGTGCTTAATTCGAAGAAACAATTAACACTTTGAAATAT
GCAAATAGAGCAAAAAATATAAAAACAAAAGTCTAAGCAAATAAGAGATTAGTCTCTATG
CATATAGCTGAGTATAAAAATATTATAAATGACCTACGCTCTGAAATAGAATAGCTCAAA
GCTAAGCTTCATGATAAAATTGGAGATAATAATGACATTCTGAATTATTAAGAAGAGGAG
CAGTAATATTTAGAAAAGTAGCATTTGAACTAACTTCCAAATGTTATTTCTGGTAACTGC
ATTTGTGGTAGATAAGAAGATGAGTAAAACATGAGAAAAATTCAAGAAGAAATATTTGAA
AATTTTTAGAATAGAATATAACTTCGTAGAGGTCTAATGGAAGTAGAAGAATAAAATGCT
ATGAATATCCTTGAGATTAAAAAAAAATAAGCAGAAATACTAGTTTGGAAGAAATCTGCA
TAATATTAGGGAAGCTAAGAAAATAACATTGAGGATTTAAATATAGATGACAGTTTATCT
AATAATTAATAACAACAAAAGGAACCTAAAAAAAAAATACCTGAAGAAATCAAATAACTA
GTTAAGGCAGTTAGAACTTTAAAAGTTGCAACTGAGAAGAACACAATTAGAAAAGAAATG
ATGACGTTAAGCTTATTAGAAAATATTGCTAATGCGAAGTTGATTCGTGATAGAATTCCA
AAAAAAATTAAACATCAAGATAAAAGGAACTATCTAGAACTTGTTATTAAAAATCATGTT
TTAGAGCTGTAAAATATTGAAATGGAAATAAACTTGCAGATCTAGGAAAAGACCATTTAA
GATTTAAAAAACATCATAGAGTCTTAAAGAAAAATAATAAATGAAAATAATATTAACAGT
CAAGCTAATGGCCTATTAAACGAAGAAGAAAACAATATTTTAAGTAATTATTCTTAAGAT
GACATAGACATAGAATTTTAAGACATAGTCGATGAAGATGATCTAAATGAAGATAAAGAT
AATTAAGATGATGATGAAGAGGATATGAATGACATAGTAATTTTTTCATTTCATTTTGAT
AGAGTCTTTTAAATTATATATTTTTTATTTACAACAAAAGACCGATCTCTAAGAAATGAT
ATAAAAATAAAAAGAATTAAGTTCTCCTATGAATAACAATGCTGCCAACAATTAAAATTA
GGATGACTTTAATATGTATGAAAAGCCTAACAAGAGAGATGATTTAGATAAAAATGGTAA
CAAAAGAGGCTCATCTAGAACTGATGTGCTTCCTGAGATAAACCAAAATAAAAGAGATAA
ATCTGCTGCTGGTTATAATAATAAACACTCATCGAAATCCTCCTAAGATAATATGATCAA
GAATTAATTTAACGATAATGAAATTAATAAGGAAACTCTGAATGAGATTGATGAAAATAA
TAATGAAGGCTTCAATAGCACTCCTAAAATGGTCTAAGGCAATTTGAAGGGGGAAAAAAA
GAAAGAGTAAATTGACCAAAAGAAAAAGAATCATAATAAATAATAGGTTGGAAAAATATG
ATTCTGGGTATGCCGACCCAAGCCAAAATTTTCTTCCAAAAAACCCTAAATTTTTGAATA
ATTTTATTTTTTCAAAAATTTAGGGTTTTTTGGAAGAAAATTTTGGCTTGGGTCGGCATA
CCCAGAATCATATTTTTTGGTTGGATTTTTAATTTTATTTTTAACACTATATTGAGTATT
AAAAAACAATATTTATAAATAAAGAATCCAAAAAAGAAAGAAGGAACCTCAGCTATCCCT
AATAATGTGTAAATAAGTATTTAAGGTTAAGCTGCAATTTAAAATTCAAAAGAAAGTGGA
AGCTTAAATATTATTTAAAGCAATTAAGGTGGTGGTATAAATAATATTTCTAATAATGTG
AATAGTATGAGTAATATAAACAGTTAGCTAAATGGGAATAATATAAACATCAATAATAAT
AATAATAACAATAATAAGGGTATGCCCTAAATCGGAAAATAAAATAATTAATAGCCATAA
AAAGACAAAGATTTTTCTGGCCTAAATTTAAAAGGAGTAATTCATTCATTTATTTATTTA
TTAATACATTTTTGATTTGGTTAATTGCATTTTTTAATATTATTTTATTATATAAAAAGA
AAAATATAATATTGCCTGCATTAAATAGTAATAACAATAATTAGAGTAACATCAATAACA
ATAATAATAATAATCCATCTTCTAATCCTAATATACCAAATAACAATTTTCTTAAAGACG
CTAATGCATAAAATCGTAAAAAGCGTTGA