Identifiers and Description

Gene Model Identifier

TTHERM_01245620

Standard Name

KIN6 (KINesin)

Aliases

PreTt07346 | 288.m00025

Description

Kinesin-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01245620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01446.19.997093137033517e-262kinesin motor domain-containin
g protein (849 aa)
OxytrichaContig415.1.g1051.9991716194688635e-85Kinesin motor domain
SGDYGL216W7.000994150992129e-77KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning
WormBaseWBGene000022307.998077742349047e-67locus:klp-20 status:Confirme
d UniProt:Q965T6 protein_i
d:CCD73793.1
DictyBaseDDB_G02931986.998463833652622e-61kif10 on chromosome: 6 positio
n 2654607 to 2658323
Stentor CoeruleusSteCoe_127664.906094730649281e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_01245620(coding)
ATGAATAGTCAACTTGAAAATAAGCCTTTAGTTATTAGGATTAAAAATGGAATTAAGTCT
CTCAGGTTAAAAACTGAGGGTGAAGTGTCAAGAAAAAAAGTCAATTAAGATTAGAATATA
GACTGCGAATAATATCAGCGAGTACTTAAAACAGAACCTTCAGAAAAGAGTTTTGAATGT
GTTGAGAAATTCAAATTAAGTGTTTGTGTGAGAGTGAGGCCAAAAACAAATTAAGAACTG
TAAGACAAAAGAAATTACTTGACACCAAAATTATAGATCTGGGATGAAAGGACAATTTAG
ATAAATTCTAATTAGGAATAATAGATTTAGATGAAACATAAAAGGAGTTTAAGCTAAGCG
AACTAAAAATCAAACATAGAACAACCTACTTAAGCATTCGAATTTGACCGTGTTTATGAA
GAATCAGCAACAAATGAAGGCATATTTTAAGAATCTGTTTCTCCCTTTTTAGACTACCTT
TTGTAAGGTTACAACTCAACTATTTTCGCATACGGCGCTTCTGGATCTGGCAAAACATTC
ACTATGTAAGGAGACAGAAAATCAGAGGGGATCACCTAATTGATATGCAAAAAACTCTTT
GAAAGAATCTAAGAAGTCTAAGAACACAAGCAGTTCAAAGTTAAATTCTCTTATGTAGAA
ATATATAATGAATAAATCAGGGATCTCATCTAATAAGGTTATTCATCTAACACTAAGAAG
TAAACCTAAAATCTAGAACTCAGAGAAGATCCTGTCAAAGGAACTATTTTGGCTAACGTT
ACAGAAGTTCAAATTGCAAATTGCGAATAAATTTAAAACTTGATAGATTTTGGAAATAAA
AATAGAACAGTTGATGCAACTACTTTGAATTCTCTATCATCTCGCTCTCATGCAGTCGTC
TAAATTCACATACAATACAAAGATATTAACTAAGGTATTTACGAATCAACACAGTTCTCT
ACCTTAACTTTAGTTGATTTGGCTGGCTCTGAGAAATCAGGAGTTTCATCAAACTAACTA
GAGACTTAAAAAATTAATTAATCGCTTCTAGTACTAGGCTACTGCATAAATTAGCTTTCA
AAGGGAAATAAAAATAATCATGTGCCATACAGAAACTCTAAATTAACTAGGATGTTGAAA
AACAGTTTAGGGGGGAACTGCAAGACCCTGATGATAGCAAATATTTCTATCGCTAACTCT
AGCTATGAAGATACCATGAACAGCTTACTCTATGCCTCGCATGCTAAGAGAATCAAAAAT
ATTTTAATTAAAAATGAAGTTACTTCTTCCTAGCATATTGCTAACTATGCTTAGCTAGTA
GAAGGTCTCTAACGCCAGAATAATTACTTAAAAAAGCTGGTAGAAGAAACAAATTAAGAT
TAAAGCTTGAAGCAAAGTAGCTAGGTATTAAATGAAAGTGTTTTCACAAAGGAAGAATCA
TAAAAACTTAAATTTGAGATTTAGAAGCACTTCGAATAGGAGACAGAATGTTATAAAGAC
ATTTCTTATATAAGCGATAGGATTAATTTAATAGAATAAGAAAATTAATAGACAATGAAT
TAGTATTAGTAATATGATCCAGTGATTAGTTTAAATAATTTATAATCCAACGAATCATCT
TGTAAATAGCTTTTAAAAGATTATAATAGCAATGTCAAGCTAGTGTCTCTTAAATAAAAT
AAGCAGATTTCTATTTAAAAACTAGAAAAACTATCTCTAAACAGAATTAATTTGCTATAA
AAAATTAAGGAATATAGTGGAGAGCAGAGAATAAAATTATTAAAGGTATTTGACCAAAAA
GCAAAATCATTCCAAGATATGATAGATAGACATAATTAATATCAATAAAAGATTACCAAT
TAAGATTAGGAAATTGATTGTCTTTTAAAGGAGTTATCAATTAAAGATAGCATTATTTAA
TCCTAAAACAATTTAATTTCAGTTAGTAATTTAGAATGCAGCCAAATTAAATATACATCT
TCTAATTTAAACAACTATTAAGAATACTAAGCCATTTAAGAAGAATCAAAACCGTTAATT
GAGTTCATAGCAAAATAAGAAACCAAAAAAGAAGCATAGAGCATTTTAGACTAAGATAAA
AATATTTTTCTTCCAACTCTTATCAAATACAAACAAAATAATAAAGTCTAAAATGCCCTT
GCCTAAATTGTTTAAGGTAAAAATAGAAGATCTCAGTCTTAATGTGATCCATATAATCAG
CCTTAGAGACTCTCTTATACCTTTGCTGTGCAAAAGCAGTTACCATAAGTCATGAAAAAA
TCTTGCAATAGTGCCTTATCTGGAGATACCCAACAGATTGCAGATGTAATACTAAATGAA
TGTAGTAAATCTAAATTCTAGAAAGCAATGTCTAAAATTAGTGTAGACACAACAATTCCA
ACAGAAACAAATGATATCACAAAATCTACTCAAAACCAAAATACGAGCAGCAATACAATT
TGTAAAATCAACAACTTCAAAAATAATAGTGAAATCATTCAACCAAAGGCTAATAAAAAC
GATACATAGTACCTTATAAAGTATTCTGATATATAGTAGAGTTTTAATTCTAAAAAATAC
AATTAGCTTTCACCGAAAGCAGATTAAGGAGAATTTACTTCTTACAGACTATAAAGTAAT
TCAAAAAATGTTATAAAATAACCTTAAAAATAATTGCAAAATGTACTTTAGTCTTCTAAA
TTCAAAAATTAAAACCCTTCAAATAGTAAAATAAAATAACCGTATTTCTCTAAATTGCTA
GTCGACTATAGTGGCTATATGTATAACGACTTAGGTCAGCTGTCTTGTAACGATATATCT
CTAAATAACAAAAAACCGTCATAAAATTTAATAGGCTCCATCGATGAAATATAAAGTCCT
ACTTAGCGTGTTAAAACAGATATTTCAGTAAGAAATAGTAGCTAAAATAAATTGGAAAGA
TTTTCAAGCAATTAATCAATAGAAATGAGTAATATATAAAGCAAAAAAATCTTTAGTAGC
AGAGAAAAAGATACAAACAATAACAGAAACAGTTCAACTTACAAAAGAAAGCACATTTCA
TCTTCAAAGCGCTAAAGTGCTAACCTCCAAAACCGTTCCTATTAGTTTTGA


>TTHERM_01245620(protein)
MNSQLENKPLVIRIKNGIKSLRLKTEGEVSRKKVNQDQNIDCEQYQRVLKTEPSEKSFEC
VEKFKLSVCVRVRPKTNQELQDKRNYLTPKLQIWDERTIQINSNQEQQIQMKHKRSLSQA
NQKSNIEQPTQAFEFDRVYEESATNEGIFQESVSPFLDYLLQGYNSTIFAYGASGSGKTF
TMQGDRKSEGITQLICKKLFERIQEVQEHKQFKVKFSYVEIYNEQIRDLIQQGYSSNTKK
QTQNLELREDPVKGTILANVTEVQIANCEQIQNLIDFGNKNRTVDATTLNSLSSRSHAVV
QIHIQYKDINQGIYESTQFSTLTLVDLAGSEKSGVSSNQLETQKINQSLLVLGYCINQLS
KGNKNNHVPYRNSKLTRMLKNSLGGNCKTLMIANISIANSSYEDTMNSLLYASHAKRIKN
ILIKNEVTSSQHIANYAQLVEGLQRQNNYLKKLVEETNQDQSLKQSSQVLNESVFTKEES
QKLKFEIQKHFEQETECYKDISYISDRINLIEQENQQTMNQYQQYDPVISLNNLQSNESS
CKQLLKDYNSNVKLVSLKQNKQISIQKLEKLSLNRINLLQKIKEYSGEQRIKLLKVFDQK
AKSFQDMIDRHNQYQQKITNQDQEIDCLLKELSIKDSIIQSQNNLISVSNLECSQIKYTS
SNLNNYQEYQAIQEESKPLIEFIAKQETKKEAQSILDQDKNIFLPTLIKYKQNNKVQNAL
AQIVQGKNRRSQSQCDPYNQPQRLSYTFAVQKQLPQVMKKSCNSALSGDTQQIADVILNE
CSKSKFQKAMSKISVDTTIPTETNDITKSTQNQNTSSNTICKINNFKNNSEIIQPKANKN
DTQYLIKYSDIQQSFNSKKYNQLSPKADQGEFTSYRLQSNSKNVIKQPQKQLQNVLQSSK
FKNQNPSNSKIKQPYFSKLLVDYSGYMYNDLGQLSCNDISLNNKKPSQNLIGSIDEIQSP
TQRVKTDISVRNSSQNKLERFSSNQSIEMSNIQSKKIFSSREKDTNNNRNSSTYKRKHIS
SSKRQSANLQNRSYQF


>TTHERM_01245620(gene)
TTAATTTGTATGAATAGTCAACTTGAAAATAAGCCTTTAGTTATTAGGATTAAAAATGGA
ATTAAGTCTCTCAGGTTAAAAACTGAGGGTGAAGTGTCAAGAAAAAAAGTCAATTAGTAA
CTTTTTATTAATGAAAATAGAGCATGATGAATTATTCTATCATTATTAACATTTTTTACA
ATGTTATTAATTATGATCATTATCATAAATATAGGCAAAGGAATATTTATTTTTTTCTAA
AAAGAGATTAGAATATAGACTGCGAATAATATCAGCGAGTACTTAAAACAGAACCTTCAG
AAAAGAGTTTTGAATGTGTTGAGAAATTCAAATTAAGTGTAAAAAATTAGATTCCTCATC
ATTGTTTATAAAGATTTTATATTGCTATTTTTACATCTTTGATTTGAGCTTTAAAGAAAT
ATAAAGCCAAAATAAATCAAATATGTGAATGAAAAAGTAAATAAATAAATAAAAAATAAT
GGATTTAAAAATTAGGTTTGTGTGAGAGTGAGGCCAAAAACAAATTAAGAACTGTAAGAC
AAAAGAAATTACTTGACACCAAAATTATAGATCTGGGATGAAAGGACAATTTAGATAAAT
TCTAATGTAATAAAGTTTATTTTTTTATTTATTTATTCTCTCAGTAGATATTATTTAATC
CATGTTTTTCATAAACAAAGTAAATTCTTTAATGATTTAATATTTTCCTATAATAGTAGG
AATAATAGATTTAGATGAAACATAAAAGGAGTTTAAGCTAAGCGAACTAAAAATCAAACA
TAGAACAACCTACTTAAGCATTCGAATTTGACCGTGTTTATGAAGAATCAGCAACAAATG
TATAAATATAATTAAATACGTTATTTTTAGATCTGTAACATTAGCAAGCATAATACATAC
ATCATTATATGTTTCTTTAATAATTAAATTTAATTGGAAACATACAAGAAATTATTTAAC
AATCAAAATTGAATATATTTTTGCAATGAAATATTGCTATTCTTAGTGTTTTTACGAGTA
ATCCATTTAATCAAAAACCAACTAACTAACTAATTAGTCATATTAAAAATTAATCCTTCA
AAAAAAAAATTGAAAAATATTTGGATATATTTCTAAAGTTAATGATAATTTTATCAAAAT
TATTAATTTTTAATTCTCACTTAGCTTACTTAATATTAATGTAATTAAAGGAAGGCATAT
TTTAAGAATCTGTTTCTCCCTTTTTAGACTACCTTTTGTAAGGTTACAACTCAACTATTT
TCGCATACGGCGCTTCTGGATCTGGCAAAACATTCACGTAAATAAAAATATTAATTTCTA
ATCAAAAATTTCGTAATTTTGATAAGCCTAACTGATATATTTTAGCAATGTTATAAGAGT
ATTTATTATAAAATTTAGGAGTCTGAAAAATTCAATTTTGAAGATAATTTAATTGTTTGA
TTGTTTTTTTGTTTGACCTATCAATAGATTTTCTTCTTACAAAAAAAATAAAGGATTTTA
ATTAAAGAATTGATATTTACAATCTTACTTTAATTTTTTGTGTTTTAATCAATCTGTAAT
CTAAAAAATTTGTTCATCTATTCCAAAATTATTATGAATTAGTATGTAAGGAGACAGAAA
ATCAGAGGGGATCACCTAATTGATATGCAAAAAACTCTTTGAAAGAATCTAAGAAGTCTA
AGAACACAAGCAGTTCAAAGTTAAATTCTCTTATGTAGAAATATATAATGAATAAATCAG
GGATCTCATCTAATAAGGTTATTCATCTAACACTAAGAAGTAAACCTAAAATCTAGAACT
CAGAGAAGATCCTGTCAAAGGAACTATTTTGGCTAACGTTACAGAAGTTCAAATTGCAAA
TTGCGAATAAATTTAAAACTTGATAGATTTTGGAAATAAAAATAGAACAGTTGATGCAAC
TACTTTGAATTCTCTATCATCTCGCTCTCATGCAGTCGTCTAAATTCACATACAATACAA
AGATATTAACTAAGGTATTTACGAATCAACACAGTTCTCTACCTTAACTTTAGTTGATTT
GGCTGGCTCTGAGAAATCAGGAGTTTCATCAAACTAACTAGAGACTTAAAAAATTAATTA
ATCGCTTCTAGGTAAAAATAAAATAATCTTTTGTAATAAGTATTTAATATTAATTTATAT
TTTGCTTAAATAGTACTAGGCTACTGCATAAATTAGCTTTCAAAGGGAAATAAAAATAAT
CATGTGCCATACAGAAACTCTAAATTAACTAGGATGTTGAAAAACAGTTTAGGGGGGAAC
TGCAAGACCCTGATGATAGCAAATATTTCTATCGCTAACTCTAGCTATGAAGATACCATG
AACAGCTTACTCTATGCCTCGCATGCTAAGAGAATCAAAAATATTTTAATTAAAAATGAA
GTTACTTCTTCCTAGCATATTGCTAACTATGCTTAGCTAGTAGAAGGTCTCTAACGCCAG
AATAATTACTTAAAAAAGCTGGTAGAAGAAACAAATTAAGATTAAAGCTTGAAGCAAAGT
ATTAAAAAAATCAAAATTATTTTATTCACCTTAATTTATTTTTAATAAATATTAAAATAA
CAAATTTATTTTCTAATTTTACCAAAAATACTAATAAATAAGAAAAATGACTTGAATTTA
AAATATAAAATTAAAAATAAATATTATGAGGTATATATTTTTTACAATAAATATGTTAAA
AATAGGTAGCTAGGTATTAAATGAAAGTGTTTTCACAAAGGAAGAATCATAAAAACTTAA
ATTTGAGATTTAGAAGCACTTCGAATAGGAGACAGAATGTTATAAAGACATTTCTTATAT
AAGCGATAGGATTAATTTAATAGAATAAGAAAATTAATAGACAATGAATTAGTATTAGTA
ATATGATCCAGTGATTAGTTTAAATAATTTATAATCCAACGAATCATCTTGTAAATAGCT
TTTAAAAGATTATAATAGCAATGTCAAGCTAGTGTCTCTTAAATAAAATAAGCAGATTTC
TATTTAAAAACTAGAAAAACTATCTCTAAACAGAATTAATTTGCTATAAGTATTATTTTT
TGTGCTAATATAAATCTATTAAAAAATATTAAATTTTATTTCATTCTATTAATAGAAAAT
TAAGGAATATAGTGGAGAGCAGAGAATAAAATTATTAAAGGTATTTGACCAAAAAGCAAA
ATCATTCCAAGATATGATAGATAGACATAATTAATATCAATAAAAGATTACCAATTAAGA
TTAGGAAATTGATTGTCTTTTAAAGGAGTTATCAATTAAAGATAGCATTATTTAATCCTA
AAACAATTTAATTTCAGTTAGTAATTTAGAATGCAGCCAAATTAAATATACATCTTCTAA
TTTAAACAACTATTAAGAATACTAAGCCATTTAAGAAGAATCAAAACCGTTAATTGAGTT
CATAGCAAAATAAGAAACCAAAAAAGAAGCATAGAGCATTTTAGACTAAGATAAAAATAT
TTTTCTTCCAACTCTTATCAAATACAAACAAAATAATAAAGTCTAAAATGCCCTTGCCTA
AATTGTTTAAGGTAAAAATAGAAGATCTCAGTCTTAATGTGATCCATATAATCAGCCTTA
GAGACTCTCTTATACCTTTGCTGTGCAAAAGCAGTTACCATAAGTCATGAAAAGTAAAAT
TTTAGTTAAAAAATTAAAAGTAAATAAAATTAATTCAAAAATAAAGAATCTTGCAATAGT
GCCTTATCTGGAGATACCCAACAGATTGCAGATGTAATACTAAATGAATGTAGTAAATCT
AAATTCTAGAAAGCAATGTCTAAAATTAGTGTAGACACAACAATTCCAACAGAAACAAAT
GATATCACAAAATCTACTCAAAACCAAAATACGAGCAGCAATACAATTTGTAAAATCAAC
AACTTCAAAAATAATAGTGAAATCATTCAACCAAAGGCTAATAAAAACGATACATAGTAC
CTTATAAAGTATTCTGATATATAGTAGAGTTTTAATTCTAAAAAATACAATTAGCTTTCA
CCGAAAGCAGATTAAGGAGAATTTACTTCTTACAGACTATAAAGTAATTCAAAAAATGTT
ATAAAATAACCTTAAAAATAATTGCAAAATGTACTTTAGTCTTCTAAATTCAAAAATTAA
AACCCTTCAAATAGTAAAATAAAATAACCGTATTTCTCTAAATTGCTAGTCGACTATAGT
GGCTATATGTATAACGACTTAGGTCAGCTGTCTTGTAACGATATATCTCTAAATAACAAA
AAACCGTCATAAAATTTAATAGGCTCCATCGATGAAATATAAAGTCCTACTTAGCGTGTT
AAAACAGATATTTCAGTAAGAAATAGTAGCTAAAATAAATTGGAAAGATTTTCAAGCAAT
TAATCAATAGAAATGAGTAATATATAAAGCAAAAAAATCTTTAGTAGCAGAGAAAAAGAT
ACAAACAATAACAGAAACAGTTCAACTTACAAAAGAAAGCACATTTCATCTTCAAAGCGC
TAAAGTGCTAACCTCCAAAACCGTTCCTATTAGTTTTGA