Identifiers and Description

Gene Model Identifier

TTHERM_00085620

Standard Name

KIN5 (Kinesin-II subfamily member; implicated in intraciliary transport; localizes in a punctate pattern a)

Aliases

PreTt16410 | 6.m00484 | 3836.m02078

Description

Kinesin motor domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03789 ) ELK domain
  • ( PF02370 ) M protein repeat
  • ( PF01920 ) Prefoldin subunit
  • ( PF00225 ) Kinesin motor domain
  • ( PF04935 ) Surfeit locus protein 6
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF04849 ) HAP1 N-terminal conserved region
  • ( TIGR01918 ) selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00085620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02457.19.997093137033517e-262kinesin motor domain-containin
g protein (851 aa)
OxytrichaContig14090.0.1.g269.997093137033517e-262Kinesin motor domain
WormBaseWBGene000038842.0005951135209932e-158locus:osm-3 Osmotic avoidanc
e abnormal protein 3 status:
Confirmed UniProt:P46873 p
rotein_id:CCD70204.1
DictyBaseDDB_G02809671.9993628512956726e-92kif3 on chromosome: 3 position
4109358 to 4113107
Stentor CoeruleusSteCoe_186311.0927656633766312e-73
SGDYBL063W2.0007889996237956e-71KIP1 Kinesin-related motor pro
tein required for mitotic spin
dle assembly, chromosome segre
gation, and 2 micron plasmid p
artitioning; functionally redu
ndant with Cin8p for chromosom
al but not plasmid functions

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14983519: Awan A, Bernstein M, Hamasaki T, Satir P (2004) Cloning and characterization of Kin5, a novel Tetrahymena ciliary kinesin II. Cell motility and the cytoskeleton 58(1):1-9
  2. Ref:10512852: Brown JM, Marsala C, Kosoy R, Gaertig J (1999) Kinesin-II is preferentially targeted to assembling cilia and is required for ciliogenesis and normal cytokinesis in Tetrahymena. Molecular biology of the cell 10(10):3081-96

Sequences

>TTHERM_00085620(coding)
ATGTCGTCTGAAACAGTTAAAGTTATGGTGAGGGCTCGTCCCATGAATAAGTTAGAAATA
TCAAAAGGTTGTGCTAACATAGTTCAAGTAGATCCATAGACAAATTAAATTATTTTATCC
AACGGAAAAGATGCAGAAGCAGCTAAAGTATTCACTTATGATTATGTATTCCCACCAGAT
ATTTAATAGCAAACAGTTTATGAAAATTCTGCTTTTCCATTAGTTGAAAGTGTAGTAGAG
GGTTATAATGGGACTATTTTCGCATATGGGCAAACAGGATGTGGCAAAACTCACTCTATG
CTTGGAAAACCAAACGATGAAGTAGAGAAGGGTATTATACCAAGAACGTTTTCACATATA
ATTAACATAGTAGAGAGTGCAAATGACAAAAATTTTTTAGTGAGATGCTCCTACATAGAA
ATTTACAACGAAGAAATACATGATTTGTTAGGTAAAGACGCAAAGGCACGTATGGATTTA
AAGGAGTATCCTGATAAAGGTGTATTTGTCAAAGATTTAACAATGAATGTAGTTAAAACA
GTAGCAGAAATGGAAAAATGGATGAACATAGGAACAGAAAATAGAAGTGTGGGTGCAACT
GCAATGAATAAGGATTCATCGCGTTCACATTCAATTTTTACTCTCTATATTGAATGTAGT
TATAAAGTAGAGGGAGATACAGAGGATCATATTACAGCTGGAAAGCTGAATCTTGTCGAT
TTAGCAGGTTCAGAAAGATAGAGCAAAACTTAAGCAACAGGAGATCGTCTTAAAGAAGCC
ACAAAAATTAATCTTTCACTATCTGCTTTAGGTAATGTCATAAGTGCTTTAGTTGATGGT
AAAAGCTAGCATGTTCCATACAGAGATAGTAAACTCACTCGTCTATTACAGGATTCTTTA
GGTGGTAATACTAAAACAATTATGATAGCAGCTATATCACCTGCAGATTATAATTATGAA
GAAACATTGAGTACTTTGAGATATGCCTCTCGTGCAAAGAATATCAAAAACTAACCAAAA
GTTAACCAAGATCCCAAGGATGCTTTGCTTAAAGAATATGCTGATGAAATTAAGAAGCTG
AAGGAGATGCTTTTGAAATAGTAAGCTGGAGAATAAGTAAATTTTAATGCTGTTGTTAAT
GGAAACGGATAGCAATAGCCTTAACTTGCTATTTAGCACAGCTCAAGTCATGTGATGAAT
TCATCAGAAGTTAAAAAACTAAAAGAAAAAAATGATGCCCTTAATGCAGAGAGACAATAA
ATAGAAGAAGAGATGAAAAATAAAGAAAAATTGTTCTAATAACAAATGCAGGAAAAATTA
ATGATTGAATAAAAGCTTAAAGAAGTGGAATAAAAGTTTATTGTGGGTGGTACTGCAGAT
TAAGATAAAAAGAAGAAAATCAGTTAAATGAGAAATAAATTAAAGAAGTAAATGTAAGAA
CATGAAAAAATTTAGGAGGAATTGAAATAGAAAGATGAAGAATTCGAAAATTTAGAAATA
AAATATTCTTCTCTATAGGAAGAACTTGACGCCACAAAAAAGAAGGTGAAAAAGCTGAAT
CAGAAATACAAATAGGCTCAAAGTGAAATAAAAGATTTAGAAAAAGAACATGAAATATAA
AAAGAGGACCTTCTTGATACGATAAGATATTAGCAAAGAGAAGTAAAAATACTTATGTCA
ATATGTTAGATGCTACTTACACCTGATGAAATAGAAATTATAAAAGGCTAAGGAGAATGG
TAAGATGATTATTAAGTATATAAATTACCTCCATTTTACTTTAAGTAAAAAAAATTAAAT
TTCCCAAAGCTTCCAGCAGCATAAGCTATGGATATGATAGATCAAGAAAAACAATCGAGG
GAAATAGATTTTATGAGATAAAATAATAATTTTGATAATAGATAAAACAATAACCATTAA
AATGGAAATTCTCACAGTCATAGTAATAGCATCAAGAGAATACCTTCCGGTACTATGGAC
AACTTTGAAGATATGAACAAATTTTAGTTTGGAAATGGGCCTGCCAAATCTAATAACACA
AGTAGATACAATAATGGCTTTTAAAATGGTAGTGATGAATTTGATTTATCCAAATATGAT
GCTGGTGGCGGCAACAGTCTTCATAGTATTCAAGAGTCTCTCAAAGAAAAAAATAACTCA
CCTAATATTAGAATTAAAAAAGCTCATAAAGTGTAACAATAACCCGAGAAGCAGAGAATT
CCAAATGTGTCTTTAGATCCTATTGAATCTCAAAGAATTTCGTAATAAAAATTAATGGGC
TTGTAAGATTCACATTTCTTAGAACCTAGCTTTTAGGGAGGAGAGTAAAGAAGATCAAAA
AATATTTAACTTTAACCGATCTAAGCAAGACCTCTAAGTAATAGTTAGACTGTGATGAAC
TTAAACTAATTAAATAAAAATAATATAAATATGAACAGCATTGATTTTGATTAAATAGCA
AATAAAACTCCAAATAGAGTTAAATTAGATAAAATTCAAGTTCCAAGGTGA


>TTHERM_00085620(protein)
MSSETVKVMVRARPMNKLEISKGCANIVQVDPQTNQIILSNGKDAEAAKVFTYDYVFPPD
IQQQTVYENSAFPLVESVVEGYNGTIFAYGQTGCGKTHSMLGKPNDEVEKGIIPRTFSHI
INIVESANDKNFLVRCSYIEIYNEEIHDLLGKDAKARMDLKEYPDKGVFVKDLTMNVVKT
VAEMEKWMNIGTENRSVGATAMNKDSSRSHSIFTLYIECSYKVEGDTEDHITAGKLNLVD
LAGSERQSKTQATGDRLKEATKINLSLSALGNVISALVDGKSQHVPYRDSKLTRLLQDSL
GGNTKTIMIAAISPADYNYEETLSTLRYASRAKNIKNQPKVNQDPKDALLKEYADEIKKL
KEMLLKQQAGEQVNFNAVVNGNGQQQPQLAIQHSSSHVMNSSEVKKLKEKNDALNAERQQ
IEEEMKNKEKLFQQQMQEKLMIEQKLKEVEQKFIVGGTADQDKKKKISQMRNKLKKQMQE
HEKIQEELKQKDEEFENLEIKYSSLQEELDATKKKVKKLNQKYKQAQSEIKDLEKEHEIQ
KEDLLDTIRYQQREVKILMSICQMLLTPDEIEIIKGQGEWQDDYQVYKLPPFYFKQKKLN
FPKLPAAQAMDMIDQEKQSREIDFMRQNNNFDNRQNNNHQNGNSHSHSNSIKRIPSGTMD
NFEDMNKFQFGNGPAKSNNTSRYNNGFQNGSDEFDLSKYDAGGGNSLHSIQESLKEKNNS
PNIRIKKAHKVQQQPEKQRIPNVSLDPIESQRISQQKLMGLQDSHFLEPSFQGGEQRRSK
NIQLQPIQARPLSNSQTVMNLNQLNKNNINMNSIDFDQIANKTPNRVKLDKIQVPR


>TTHERM_00085620(gene)
ATGTCGTCTGAAACAGTTAAAGTTATGGTGAGGGCTCGTCCCATGAATAAGTTAGAAATA
TCAAAAGGTTGTGCTAACATAGTTCAAGTAGATCCATAGACAAATTAAATTATTTTATCC
AACGGAAAAGATGCAGAAGCAGCTAAAGTATTCACTTATGATTATGTATTCCCACCAGAT
ATTTAATAGCAAACAGTTTATGAAAATTCTGCTTTTCCATTAGTTGAAAGTGTAGTAGAG
GGTTATAATGGGACTATTTTCGCATATGGGCAAACAGGTTAGAATAGAATTTTTATATAA
AATATATTTGAGATGAAGGTTTTGTTAATTGCCTTTCGAATTTCGTTATTTTATCGAATT
GAAACTTAAAAAAGTCTATATGAATGATTGAATAATTCAATTGTGATAAATAAGTTTGAA
TATGGAAAATAAATAATTCTATTTTAATAAAAAAGGATGTGGCAAAACTCACTCTATGCT
TGGAAAACCAAACGATGAAGTAGAGAAGGGTATTATACCAAGAACGTTTTCACATATAAT
TAACATAGTAGAGAGTGCAAATGACAAAAATTTTTTAGTGAGATGCTCCTACATAGAAAT
TTACAACGAAGAAATACATGATTTGTTAGGTAAAGACGCAAAGGCACGTATGGATTTAAA
GGAGTATCCTGATAAAGGTGTATTTGTCAAAGATTTAACAATGAATGTAGTTAAAACAGT
AGCAGAAATGGAAAAATGGATGAACATAGGAACAGAAAATAGAAGTGTGGGTGCAACTGC
AATGAATAAGGATTCATCGCGTTCACATTCAATTTTTACTCTCTATATTGAATGTAGTTA
TAAAGTAGAGGGAGATACAGAGGATCATATTACAGCTGGAAAGCTGAATCTTGTCGATTT
AGCAGGTTCAGAAAGGTATTAATTTCAAGCTTAAAATCTTTCATTTAATTGAAGCAAATT
TAAAGAATATCTTCACTGCAATTTAAGCTATCAAAATAGAGAAAAATAAAAAAAAGGAGA
GTGCTGGTTATTTTTTTTTAATTTTTGCAATCAATATGAATTAAAGAGTAAACATTAAGA
ATAAATAAATAAATATTGATTGATATATTATTCATTCACAATCAAACAAAAATCAAGCAA
ATTAAATAACCAATACTTTTTCATTTTATTTTTTAATGTTTAATTACTTAATAAAAAAAG
ATAGAGCAAAACTTAAGCAACAGGAGATCGTCTTAAAGAAGCCACAAAAATTAATCTTTC
ACTATCTGCTTTAGGTAATGTCATAAGTGCTTTAGTTGATGGTAAAAGCTAGCATGTTCC
ATACAGAGATAGTAAACTCACTCGTCTATTACAGGTAAAAATTAAATTTATTCATTCATT
AATAATCACACTAGATTTCTTTAATATTTAAATATTAGTGATAGAAGTAAGTTTTTATCA
GAAATTTATGTCTAAATTTAGATTTATTTTTTTTAAAAAGTTAATATTAACAAAAAAAAA
AATGATAATATTTAAAAAAAAATATTGATGAAACTAAATAAAATATTTAAAAAATTAAAA
AAAATATTTTATAATTTTATAAAATTGATTAAGAGAAAATATTCAAAAACTTTAATAAAA
AAAGATTTAAAAATATTAGTTTTGAATCAAATTGCAAAGCATAAATTTTATTTAATTTAA
TATTATTTTATTTATTAAATATCCTAAAATGGATTGTAATATATTTGAATAATCTTACAA
TGATTTTATTATTTTAATAAATAATAATTTTTATGATTAATAAAGGATTCTTTAGGTGGT
AATACTAAAACAATTATGATAGCAGCTATATCACCTGCAGATTATAATTATGAAGAAACA
TTGAGTACTTTGAGATATGCCTCTCGTGCAAAGAATATCAAAAACTAACCAAAAGTTAAC
CAAGATCCCAAGGATGCTTTGCTTAAAGAATATGCTGATGAAATTAAGAAGCTGAAGGAG
ATGCTTTTGAAATAGTAAGCTGGAGAATAAGTAAATTTTAATGCTGTTGTTAATGGAAAC
GGATAGCAATAGCCTTAACTTGCTATTTAGCACAGCTCAAGTCATGTGATGAATTCATCA
GAAGTTAAAAAACTAAAAGAAAAAAATGATGCCCTTAATGCAGAGAGACAATAAATAGAA
GAAGAGATGAAAAATAAAGAAAAATTGTTCTAATAACAAATGCAGGAAAAATTAATGATT
GAATAAAAGCTTAAAGAAGTGGAATAAAAGTTTATTGTGGGTGGTACTGCAGATTAAGAT
AAAAAGAAGAAAATCAGTTAAATGAGAAATAAATTAAAGAAGTAAATGTAAGAACATGAA
AAAATTTAGGAGGAATTGAAATAGAAAGATGAAGAATTCGAAAATTTAGAAATAAAATAT
TCTTCTCTATAGGAAGAACTTGACGCCACAAAAAAGAAGGTGAAAAAGCTGAATCAGAAA
TACAAATAGGCTCAAAGTGAAATAAAAGATTTAGAAAAAGAACATGAAATATAAAAAGAG
GACCTTCTTGATACGATAAGATATTAGCAAAGAGAAGTAAAAATACTTATGTCAATATGT
TAGATGCTACTTACACCTGATGAAATAGAAATTATAAAAGGCTAAGGAGAATGGTAAGAT
GATTATTAAGTATATAAATTACCTCCATTTTACTTTAAGTAAAAAAAATTAAATTTCCCA
AAGCTTCCAGCAGCATAAGGTATGATTGATTTAATTAATAATAATTTTAAAGTTAAAAAT
TTTCTTTATAATCTTAATAGCTATGGATATGATAGATCAAGAAAAACAATCGAGGGAAAT
AGATTTTATGAGATAAAATAATAATTTTGATAATAGATAAAACAATAACCATTAAAATGG
AAATTCTCACAGTCATAGTAATAGCATCAAGAGAATACCTTCCGGTACTATGGACAACTT
TGAAGATATGAACAAATTTTAGTTTGGAAATGGGCCTGCCAAATCTAATAACACAAGTAG
ATACAATAATGGCTTTTAAAATGGTAGTGATGAATTTGATTTATCCAAATATGATGCTGG
TGGCGGCAACAGTCTTCATAGTATTCAAGAGTCTCTCAAAGAAAAAAATAACTCACCTAA
TATTAGAATTAAAAAAGGTAAATAATAAATAAATAAAGTTTTAAAATAAAAATGAATATT
TTAAAAAGTATCAAAAAAATGATGGATATTTTACTAATATGTGGATAAAGGAAAAATATT
TTCTAATAAACATTAAAGTTTTACTTTTAATTAACAAATTTATGCATGTAGATTCTAATG
GAATATTAATTAAAAATACGTTAAATTTATTTGTTCCATATTATTAAAGAACTAGCTAAT
TTTATGAAATATTTGCAAATTAATTGATTTTTTTATTCAAAAAGCTCATAAAGTGTAACA
ATAACCCGAGAAGCAGAGAATTCCAAATGTGTCTTTAGATCCTATTGAATCTCAAAGAAT
TTCGTAATAAAAATTAATGGGCTTGTAAGATTCACATTTCTTAGAACCTAGCTTTTAGGG
AGGAGAGTAAAGAAGATCAAAAAGTAAATTTAAGATTTAATTTAAAGAATTAAAAAAATA
ATTAAAACTTTTTAATTTATGATTTAGATATTTAACTTTAACCGATCTAAGCAAGACCTC
TAAGTAATAGTTAGACTGTGATGAACTTAAACTAATTAAATAAAAATAATATAAATATGA
ACAGCATTGATTTTGATTAAATAGCAAATAAAACTCCAAATAGAGTTAAATTAGATAAAA
TTCAAGTTCCAAGGTGA