Identifiers and Description

Gene Model Identifier

TTHERM_00263330

Standard Name

KIN2 (KINesin)

Aliases

PreTt29398 | 23.m00294

Description

KIN2 kinesin motor catalytic domain protein; Kinesin-II heavy chain homolog; implicated in intraciliary transport; shares essential functions with KIN1 in ciliary assembly and maintenance- rotokinesis and phagocytosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00263330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_297480
Tetrahymena borealisEI9_14207.19.997093137033517e-262kinesin motor domain-containin
g protein (734 aa)
OxytrichaContig740.0.g1013.000294738490095e-167Kinesin motor domain
WormBaseWBGene000022229.995938456217754e-149locus:klp-11 status:Partiall
y_confirmed UniProt:Q19633
protein_id:CAA92295.2
DictyBaseDDB_G02809679.996584278131743e-91kif3 on chromosome: 3 position
4109358 to 4113107
SGDYBL063W6.997420649987812e-71KIP1 Kinesin-related motor pro
tein required for mitotic spin
dle assembly, chromosome segre
gation, and 2 micron plasmid p
artitioning; functionally redu
ndant with Cin8p for chromosom
al but not plasmid functions

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14983519: Awan A, Bernstein M, Hamasaki T, Satir P (2004) Cloning and characterization of Kin5, a novel Tetrahymena ciliary kinesin II. Cell motility and the cytoskeleton 58(1):1-9
  2. Ref:12925756: Brown JM, Fine NA, Pandiyan G, Thazhath R, Gaertig J (2003) Hypoxia regulates assembly of cilia in suppressors of Tetrahymena lacking an intraflagellar transport subunit gene. Molecular biology of the cell 14(8):3192-207
  3. Ref:10772758: Brown JM, Hardin C, Gaertig J (1999) Rotokinesis, a novel phenomenon of cell locomotion-assisted cytokinesis in the ciliate Tetrahymena thermophila. Cell biology international 23(12):841-8
  4. Ref:11212349: Cole DG (1999) Kinesin-II, the heteromeric kinesin. Cell Mol Life Sci 56(3-4):217-26
  5. Ref:10512852: Brown JM, Marsala C, Kosoy R, Gaertig J (1999) Kinesin-II is preferentially targeted to assembling cilia and is required for ciliogenesis and normal cytokinesis in Tetrahymena. Molecular biology of the cell 10(10):3081-96

Sequences

>TTHERM_00263330(coding)
ATGACTACAAGTAAAAACAACAGCGAATGCTTTAAGGTAGCTGTAAGATGCAGACCCCTA
AATAATGATGAAATATAAAATGAAAGAAGTTCAGTTGTTTCTGTAAACCCTCAAAGAGGA
GAAATATAAATCAAACAAAAGCATGATTAAGCTGAACAACATAGGATTTTTGCATTTGAC
TAAGTTTTCGAACCTGATATTTAATAAGAGGTTGTGTATAAATGTATTGCCTACCCTATT
GTTGAGAGCGTTTTAGAAGGCTACAATGGAACAATTTTCGCTTATGGCTAAACTGGTACT
GGAAAAACGCATACTATTTAAGGGAGAAATGAGCCAATTAATGAAAGAGGTATCATTCCT
AGGGCTTTTGAACATATTTTCCACTCTATTAAAGGCTCGCCAAACACTTAATTTTTAGTA
CATGTTAGTTTTCTTGAATTATATAATGAAGAGATTTAAGACTTGCTTTCCACCAAGAAT
AAAAAATTAGAATTAAGAGAAAAAGCAGAGACTGGCGTCTTTGTGAAAGATTTAACTAGT
TTTTTAGTTTAAAATGAATAGGAATTAAATGATAAATTTTAGCAAGGTATTTTGAATCGT
AAAGTTGGTTAAACTAAAATGAGTTCATGTTCATCTCGTTCTCACTCTATCCTTTCTGTA
ACTATTGAGAGGTGCGATGTTGTGAATGGGGAAAACCATATTAAAGTAGGTAAGTTAAAT
TTAGTTGACCTCGCTGGATCTGAACGTTAAAGTAAAACTCAAGCAACAGGCTCTCGTTTT
AAAGAAGGAGTATATATTAACTTAAGTTTAACTACTTTAGGTAATGTTATTTCCTCTCTC
ATCGATCCTAAAGCTTCTCATATTCCATATAGAGATTCTAAATTGACTAGAATTCTTTAA
GACTCTCTAGGTGGCAACACCAAAACTGTGATGATCGCTAATATTGGTCCTGCTGATTAT
AACTAAGATGAAACAATATCTACTTTAAGATATGCTCACAGAGCGAAATCAATATAAAAT
CATGCTTAAATTAACGAGGATCCCAAATAAGCAATGATAAGAAAATTTTAAGAGGAAATA
TCTAGCTTAAAATAGTAGTTATCAGGTTTACTTGAAACTGGAGGAGATTTTAATATGAAT
GCTGAAGTTAAAAAGATAGAAAAAATTGTTTTTAAATATGATGACGAAGAAATTATAAAA
TTGAAACAAAAACTTGAATAACAAAAATCTGATATTGAAAATAACTATGAAAATGAAGTA
AAGAAAATAGAAGAAGATAAGTAGTTACAGGAAAAAGAAAAGTAGCAGCTTATTTATTAG
CTTCAGGAAAAAGAACAAAAGTAGCAATAATAAAAATAGCAATAATAAAAACTACTTGGT
AAACTTTAGAAAATGTAACATAAAGTAATACAAGGAGAAGAAACTATGTAGAGAGTTCTT
GAAAACGAAAGATAACTGAATAAAGAATTGCAATAAGCAAATGAAAGAGATCGCTAAGCA
GCTTTACAAATCTAATAAAATGAAGATTTTATATTAGAGATAAACATGAAATTTAAGAAC
CAAGTTGAAGAAAAATAAGAAAAATAGAAAAGAATAAATCTTTTATTTGATAGATTGTGC
TAAATTTAATAATAAAATAAAGATATTGATGAATTTTATGTTTCTGAAATAGACTAGCTA
TAAGAAAGTTACAGAGACTTACAGAAAGAATTAAAATTAAAAAGATTTATCTTAGATTAT
TTCATTCCTTAAAAAGAATTAAAAAGATTATCAGAGAAAGCTATGTATAGTGAAGAATAA
CAAAATTGGGTATATCCTATTCAAAATTTGACTGGTAAATATATGAGAAGATCTGATGAA
AGTTAAGTTTCCCTTAAAGAAATTTAATCTGAAGATCTAGAACAAGATTCAAAAGTTTAT
TTTGTATACACAGAGCAAGGACCTATTAGAGAATAGTTTTTTTACACAACTGAAATAAAA
AAGCAAGAATATGCTTAACGAAAAAATGATCCTCTTAAACAAAATTTTGAATAATCAAAT
ACTTAATTTGTAAAAACTAAAAAGAGATCTAAAAGTTAAATAAATTAAATCTGA


>TTHERM_00263330(protein)
MTTSKNNSECFKVAVRCRPLNNDEIQNERSSVVSVNPQRGEIQIKQKHDQAEQHRIFAFD
QVFEPDIQQEVVYKCIAYPIVESVLEGYNGTIFAYGQTGTGKTHTIQGRNEPINERGIIP
RAFEHIFHSIKGSPNTQFLVHVSFLELYNEEIQDLLSTKNKKLELREKAETGVFVKDLTS
FLVQNEQELNDKFQQGILNRKVGQTKMSSCSSRSHSILSVTIERCDVVNGENHIKVGKLN
LVDLAGSERQSKTQATGSRFKEGVYINLSLTTLGNVISSLIDPKASHIPYRDSKLTRILQ
DSLGGNTKTVMIANIGPADYNQDETISTLRYAHRAKSIQNHAQINEDPKQAMIRKFQEEI
SSLKQQLSGLLETGGDFNMNAEVKKIEKIVFKYDDEEIIKLKQKLEQQKSDIENNYENEV
KKIEEDKQLQEKEKQQLIYQLQEKEQKQQQQKQQQQKLLGKLQKMQHKVIQGEETMQRVL
ENERQLNKELQQANERDRQAALQIQQNEDFILEINMKFKNQVEEKQEKQKRINLLFDRLC
QIQQQNKDIDEFYVSEIDQLQESYRDLQKELKLKRFILDYFIPQKELKRLSEKAMYSEEQ
QNWVYPIQNLTGKYMRRSDESQVSLKEIQSEDLEQDSKVYFVYTEQGPIREQFFYTTEIK
KQEYAQRKNDPLKQNFEQSNTQFVKTKKRSKSQINQI


>TTHERM_00263330(gene)
ATGACTACAAGTAAAAACAACAGCGAATGCTTTAAGGTAGCTGTAAGATGCAGACCCCTA
AATAATGATGAAATATAAAATGAAAGAAGTTCAGTTGTTTCTGTAAACCCTCAAAGAGGA
GAAATATAAATCAAACAAAAGCATGATTAAGCTGAACAACATAGGATTTTTGCATTTGAC
TAAGTTTTCGAACCTGATATTTAATAAGAGGTTGTGTATAAATGTATTGCCTACCCTATT
GTTGAGAGCGTTTTAGAAGGCTACAATGGAACAATTTTCGCTTATGGCTAAACTGGTACT
GGAAAAACGCATACTATTTAAGGGAGAAATGAGCCAATTAATGAAAGAGGTATCATTCCT
AGGGCTTTTGAACATATTTTCCACTCTATTAAAGGCTCGCCAAACACTTAATTTTTAGTA
CATGTTAGTTTTCTTGAATTATATAATGAAGAGATTTAAGACTTGCTTTCCACCAAGAAT
AAAAAATTAGAATTAAGAGAAAAAGCAGAGACTGGCGTCTTTGTGAAAGATTTAACTAGT
TTTTTAGTTTAAAATGAATAGGAATTAAATGATAAATTTTAGCAAGGTATTTTGAATCGT
AAAGTTGGTTAAACTAAAATGAGTTCATGTTCATCTCGTTCTCACTCTATCCTTTCTGTA
ACTATTGAGAGGTGCGATGTTGTGAATGGGGAAAACCATATTAAAGTAGGTAAGTTAAAT
TTAGTTGACCTCGCTGGATCTGAACGTTAAAGTAAAACTCAAGCAACAGGCTCTCGTTTT
AAAGAAGGAGTATATATTAACTTAAGTTTAACTACTTTAGGTAATGTTATTTCCTCTCTC
ATCGATCCTAAAGCTTCTCATATTCCATATAGAGATTCTAAATTGACTAGAATTCTTTAA
GACTCTCTAGGTGGCAACACCAAAACTGTGATGATCGCTAATATTGGTAACAAGCGATTT
AAAATAAAACATAACAAATTAAAATTTATTATTAAAATTCTTAATATAATCTTTAATTTT
ACAAAAATAATTTCTTTCTGAAATAGCGAAAGTTTAATCAAACCATTTATTTTATAAATT
TTCCTTTAAAAGAATTTTTATTAACTTTTTAATATTTTTTATAAATTGTGTGTACTTTTT
TTTTTAACAGGTCCTGCTGATTATAACTAAGATGAAACAATATCTACTTTAAGATATGCT
CACAGAGCGAAATCAATATAAAATCATGCTTAAATTAACGAGGATCCCAAATAAGCAATG
ATAAGAAAATTTTAAGAGGAAATATCTAGCTTAAAATAGTAGTTATCAGGTTTACTTGAA
ACTGGAGGAGATTTTAATATGAATGCTGAAGTTAAAAAGGTAATTCAGATATTTTTTTAT
TAAAAAGAAAATAGTTTTAAGATTTAATAAACTTAATATTTATTAGATAGAAAAAATTGT
TTTTAAATATGATGACGAAGAAATTATAAAATTGAAACAAAAACTTGAATAACAAAAATC
TGATATTGAAAATAACTATGAAAATGAAGTAAAGAAAATAGAAGAAGATAAGTAGTTACA
GGAAAAAGAAAAGTAGCAGCTTATTTATTAGCTTCAGGAAAAAGAACAAAAGTAGCAATA
ATAAAAATAGCAATAATAAAAACTACTTGGTAAACTTTAGAAAATGTAACATAAAGTAAT
ACAAGGAGAAGAAACTATGTAGAGAGTTCTTGAAAACGAAAGATAACTGAATAAAGAATT
GCAATAAGCAAATGAAAGAGATCGCTAAGCAGCTTTACAAATCTAATAAAATGAAGATTT
TATATTAGAGATAAACATGAAATTTAAGAACCAAGTTGAAGAAAAATAAGAAAAATAGAA
AAGAATAAATCTTTTATTTGATAGATTGTGCTAAATTTAATAATAAAATAAAGATATTGA
TGAATTTTATGTTTCTGAAATAGACTAGCTATAAGAAAGTTACAGAGACTTACAGAAAGA
ATTAAAATTAAAAAGATTTATCTTAGATTATTTCATTCCTTAAAAAGAATTAAAAAGATT
ATCAGTAAATATTTTTTTTTAATATTAGTCTTATTTTCATCATTAAATAAAATTAGGAGA
AAGCTATGTATAGTGAAGAATAACAAAATTGGGTATATCCTATTCAAAATTTGACTGGTA
AATATATGAGAAGATCTGATGAAAGTTAAGTTTCCCTTAAAGAAATTTAATCTGAAGATC
TAGAACAAGATTCAAAAGTTTATTTTGTATACACAGAGCAAGGACCTATTAGAGAATAGT
TTTTTTACACAACTGAAATAAAAAAGCAAGAATATGCTTAACGAAAAAATGATCCTCTTA
AACAAAATTTTGAATAATCAAATACTTAATTTGTAAAAACTAAAAAGAGATCTAAAAGTT
AAATAAATTAAATCTGA