Identifiers and Description

Gene Model Identifier

TTHERM_00263330

Standard Name

KIN2 (KINesin)

Aliases

PreTt29398 | 23.m00294

Description

Kinesin-II heavy chain homolog; implicated in intraciliary transport; shares essential functions with KIN1 in ciliary assembly and maintenance, rotokinesis and phagocytosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00263330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_297480
Tetrahymena borealisEI9_14207.19.997093137033517e-262kinesin motor domain-containin
g protein (734 aa)
OxytrichaContig740.0.g1013.000294738490095e-167Kinesin motor domain
WormBaseWBGene000022229.995938456217754e-149locus:klp-11 status:Partiall
y_confirmed UniProt:Q19633
protein_id:CAA92295.2
DictyBaseDDB_G02809679.996584278131743e-91kif3 on chromosome: 3 position
4109358 to 4113107
SGDYBL063W6.997420649987812e-71KIP1 Kinesin-related motor pro
tein required for mitotic spin
dle assembly, chromosome segre
gation, and 2 micron plasmid p
artitioning; functionally redu
ndant with Cin8p for chromosom
al but not plasmid functions

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14983519: Awan A, Bernstein M, Hamasaki T, Satir P (2004) Cloning and characterization of Kin5, a novel Tetrahymena ciliary kinesin II. Cell motility and the cytoskeleton 58(1):1-9
  2. Ref:12925756: Brown JM, Fine NA, Pandiyan G, Thazhath R, Gaertig J (2003) Hypoxia regulates assembly of cilia in suppressors of Tetrahymena lacking an intraflagellar transport subunit gene. Molecular biology of the cell 14(8):3192-207
  3. Ref:10772758: Brown JM, Hardin C, Gaertig J (1999) Rotokinesis, a novel phenomenon of cell locomotion-assisted cytokinesis in the ciliate Tetrahymena thermophila. Cell biology international 23(12):841-8
  4. Ref:11212349: Cole DG (1999) Kinesin-II, the heteromeric kinesin. Cell Mol Life Sci 56(3-4):217-26
  5. Ref:10512852: Brown JM, Marsala C, Kosoy R, Gaertig J (1999) Kinesin-II is preferentially targeted to assembling cilia and is required for ciliogenesis and normal cytokinesis in Tetrahymena. Molecular biology of the cell 10(10):3081-96

Sequences

>TTHERM_00263330(coding)
ATGACTACAAGTAAAAACAACAGCGAATGCTTTAAGGTAGCTGTAAGATGCAGACCCCTA
AATAATGATGAAATATAAAATGAAAGAAGTTCAGTTGTTTCTGTAAACCCTCAAAGAGGA
GAAATATAAATCAAACAAAAGCATGATTAAGCTGAACAACATAGGATTTTTGCATTTGAC
TAAGTTTTCGAACCTGATATTTAATAAGAGGTTGTGTATAAATGTATTGCCTACCCTATT
GTTGAGAGCGTTTTAGAAGGCTACAATGGAACAATTTTCGCTTATGGCTAAACTGGTACT
GGAAAAACGCATACTATTTAAGGGAGAAATGAGCCAATTAATGAAAGAGGTATCATTCCT
AGGGCTTTTGAACATATTTTCCACTCTATTAAAGGCTCGCCAAACACTTAATTTTTAGTA
CATGTTAGTTTTCTTGAATTATATAATGAAGAGATTTAAGACTTGCTTTCCACCAAGAAT
AAAAAATTAGAATTAAGAGAAAAAGCAGAGACTGGCGTCTTTGTGAAAGATTTAACTAGT
TTTTTAGTTTAAAATGAATAGGAATTAAATGATAAATTTTAGCAAGGTATTTTGAATCGT
AAAGTTGGTTAAACTAAAATGAGTTCATGTTCATCTCGTTCTCACTCTATCCTTTCTGTA
ACTATTGAGAGGTGCGATGTTGTGAATGGGGAAAACCATATTAAAGTAGGTAAGTTAAAT
TTAGTTGACCTCGCTGGATCTGAACGTTAAAGTAAAACTCAAGCAACAGGCTCTCGTTTT
AAAGAAGGAGTATATATTAACTTAAGTTTAACTACTTTAGGTAATGTTATTTCCTCTCTC
ATCGATCCTAAAGCTTCTCATATTCCATATAGAGATTCTAAATTGACTAGAATTCTTTAA
GACTCTCTAGGTGGCAACACCAAAACTGTGATGATCGCTAATATTGGTCCTGCTGATTAT
AACTAAGATGAAACAATATCTACTTTAAGATATGCTCACAGAGCGAAATCAATATAAAAT
CATGCTTAAATTAACGAGGATCCCAAATAAGCAATGATAAGAAAATTTTAAGAGGAAATA
TCTAGCTTAAAATAGTAGTTATCAGGTTTACTTGAAACTGGAGGAGATTTTAATATGAAT
GCTGAAGTTAAAAAGATAGAAAAAATTGTTTTTAAATATGATGACGAAGAAATTATAAAA
TTGAAACAAAAACTTGAATAACAAAAATCTGATATTGAAAATAACTATGAAAATGAAGTA
AAGAAAATAGAAGAAGATAAGTAGTTACAGGAAAAAGAAAAGTAGCAGCTTATTTATTAG
CTTCAGGAAAAAGAACAAAAGTAGCAATAATAAAAATAGCAATAATAAAAACTACTTGGT
AAACTTTAGAAAATGTAACATAAAGTAATACAAGGAGAAGAAACTATGTAGAGAGTTCTT
GAAAACGAAAGATAACTGAATAAAGAATTGCAATAAGCAAATGAAAGAGATCGCTAAGCA
GCTTTACAAATCTAATAAAATGAAGATTTTATATTAGAGATAAACATGAAATTTAAGAAC
CAAGTTGAAGAAAAATAAGAAAAATAGAAAAGAATAAATCTTTTATTTGATAGATTGTGC
TAAATTTAATAATAAAATAAAGATATTGATGAATTTTATGTTTCTGAAATAGACTAGCTA
TAAGAAAGTTACAGAGACTTACAGAAAGAATTAAAATTAAAAAGATTTATCTTAGATTAT
TTCATTCCTTAAAAAGAATTAAAAAGATTATCAGAGAAAGCTATGTATAGTGAAGAATAA
CAAAATTGGGTATATCCTATTCAAAATTTGACTGGTAAATATATGAGAAGATCTGATGAA
AGTTAAGTTTCCCTTAAAGAAATTTAATCTGAAGATCTAGAACAAGATTCAAAAGTTTAT
TTTGTATACACAGAGCAAGGACCTATTAGAGAATAGTTTTTTTACACAACTGAAATAAAA
AAGCAAGAATATGCTTAACGAAAAAATGATCCTCTTAAACAAAATTTTGAATAATCAAAT
ACTTAATTTGTAAAAACTAAAAAGAGATCTAAAAGTTAAATAAATTAAATCTGA


>TTHERM_00263330(protein)
MTTSKNNSECFKVAVRCRPLNNDEIQNERSSVVSVNPQRGEIQIKQKHDQAEQHRIFAFD
QVFEPDIQQEVVYKCIAYPIVESVLEGYNGTIFAYGQTGTGKTHTIQGRNEPINERGIIP
RAFEHIFHSIKGSPNTQFLVHVSFLELYNEEIQDLLSTKNKKLELREKAETGVFVKDLTS
FLVQNEQELNDKFQQGILNRKVGQTKMSSCSSRSHSILSVTIERCDVVNGENHIKVGKLN
LVDLAGSERQSKTQATGSRFKEGVYINLSLTTLGNVISSLIDPKASHIPYRDSKLTRILQ
DSLGGNTKTVMIANIGPADYNQDETISTLRYAHRAKSIQNHAQINEDPKQAMIRKFQEEI
SSLKQQLSGLLETGGDFNMNAEVKKIEKIVFKYDDEEIIKLKQKLEQQKSDIENNYENEV
KKIEEDKQLQEKEKQQLIYQLQEKEQKQQQQKQQQQKLLGKLQKMQHKVIQGEETMQRVL
ENERQLNKELQQANERDRQAALQIQQNEDFILEINMKFKNQVEEKQEKQKRINLLFDRLC
QIQQQNKDIDEFYVSEIDQLQESYRDLQKELKLKRFILDYFIPQKELKRLSEKAMYSEEQ
QNWVYPIQNLTGKYMRRSDESQVSLKEIQSEDLEQDSKVYFVYTEQGPIREQFFYTTEIK
KQEYAQRKNDPLKQNFEQSNTQFVKTKKRSKSQINQI


>TTHERM_00263330(gene)
AGAATAAAAAAAAGAGATAAAATCATGACTACAAGTAAAAACAACAGCGAATGCTTTAAG
GTAGCTGTAAGATGCAGACCCCTAAATAATGATGAAATATAAAATGAAAGAAGTTCAGTT
GTTTCTGTAAACCCTCAAAGAGGAGAAATATAAATCAAACAAAAGCATGATTAAGCTGAA
CAACATAGGATTTTTGCATTTGACTAAGTTTTCGAACCTGATATTTAATAAGAGGTTGTG
TATAAATGTATTGCCTACCCTATTGTTGAGAGCGTTTTAGAAGGCTACAATGGAACAATT
TTCGCTTATGGCTAAACTGGTACTGGAAAAACGCATACTATTTAAGGGAGAAATGAGCCA
ATTAATGAAAGAGGTATCATTCCTAGGGCTTTTGAACATATTTTCCACTCTATTAAAGGC
TCGCCAAACACTTAATTTTTAGTACATGTTAGTTTTCTTGAATTATATAATGAAGAGATT
TAAGACTTGCTTTCCACCAAGAATAAAAAATTAGAATTAAGAGAAAAAGCAGAGACTGGC
GTCTTTGTGAAAGATTTAACTAGTTTTTTAGTTTAAAATGAATAGGAATTAAATGATAAA
TTTTAGCAAGGTATTTTGAATCGTAAAGTTGGTTAAACTAAAATGAGTTCATGTTCATCT
CGTTCTCACTCTATCCTTTCTGTAACTATTGAGAGGTGCGATGTTGTGAATGGGGAAAAC
CATATTAAAGTAGGTAAGTTAAATTTAGTTGACCTCGCTGGATCTGAACGTTAAAGTAAA
ACTCAAGCAACAGGCTCTCGTTTTAAAGAAGGAGTATATATTAACTTAAGTTTAACTACT
TTAGGTAATGTTATTTCCTCTCTCATCGATCCTAAAGCTTCTCATATTCCATATAGAGAT
TCTAAATTGACTAGAATTCTTTAAGACTCTCTAGGTGGCAACACCAAAACTGTGATGATC
GCTAATATTGGTAACAAGCGATTTAAAATAAAACATAACAAATTAAAATTTATTATTAAA
ATTCTTAATATAATCTTTAATTTTACAAAAATAATTTCTTTCTGAAATAGCGAAAGTTTA
ATCAAACCATTTATTTTATAAATTTTCCTTTAAAAGAATTTTTATTAACTTTTTAATATT
TTTTATAAATTGTGTGTACTTTTTTTTTTAACAGGTCCTGCTGATTATAACTAAGATGAA
ACAATATCTACTTTAAGATATGCTCACAGAGCGAAATCAATATAAAATCATGCTTAAATT
AACGAGGATCCCAAATAAGCAATGATAAGAAAATTTTAAGAGGAAATATCTAGCTTAAAA
TAGTAGTTATCAGGTTTACTTGAAACTGGAGGAGATTTTAATATGAATGCTGAAGTTAAA
AAGGTAATTCAGATATTTTTTTATTAAAAAGAAAATAGTTTTAAGATTTAATAAACTTAA
TATTTATTAGATAGAAAAAATTGTTTTTAAATATGATGACGAAGAAATTATAAAATTGAA
ACAAAAACTTGAATAACAAAAATCTGATATTGAAAATAACTATGAAAATGAAGTAAAGAA
AATAGAAGAAGATAAGTAGTTACAGGAAAAAGAAAAGTAGCAGCTTATTTATTAGCTTCA
GGAAAAAGAACAAAAGTAGCAATAATAAAAATAGCAATAATAAAAACTACTTGGTAAACT
TTAGAAAATGTAACATAAAGTAATACAAGGAGAAGAAACTATGTAGAGAGTTCTTGAAAA
CGAAAGATAACTGAATAAAGAATTGCAATAAGCAAATGAAAGAGATCGCTAAGCAGCTTT
ACAAATCTAATAAAATGAAGATTTTATATTAGAGATAAACATGAAATTTAAGAACCAAGT
TGAAGAAAAATAAGAAAAATAGAAAAGAATAAATCTTTTATTTGATAGATTGTGCTAAAT
TTAATAATAAAATAAAGATATTGATGAATTTTATGTTTCTGAAATAGACTAGCTATAAGA
AAGTTACAGAGACTTACAGAAAGAATTAAAATTAAAAAGATTTATCTTAGATTATTTCAT
TCCTTAAAAAGAATTAAAAAGATTATCAGTAAATATTTTTTTTTAATATTAGTCTTATTT
TCATCATTAAATAAAATTAGGAGAAAGCTATGTATAGTGAAGAATAACAAAATTGGGTAT
ATCCTATTCAAAATTTGACTGGTAAATATATGAGAAGATCTGATGAAAGTTAAGTTTCCC
TTAAAGAAATTTAATCTGAAGATCTAGAACAAGATTCAAAAGTTTATTTTGTATACACAG
AGCAAGGACCTATTAGAGAATAGTTTTTTTACACAACTGAAATAAAAAAGCAAGAATATG
CTTAACGAAAAAATGATCCTCTTAAACAAAATTTTGAATAATCAAATACTTAATTTGTAA
AAACTAAAAAGAGATCTAAAAGTTAAATAAATTAAATCTGA