Identifiers and Description

Gene Model Identifier

TTHERM_00633600

Standard Name

KIN143 (KINesin)

Aliases

PreTt28029 | 90.m00193

Description

Kinesin motor domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05372 ) Delta lysin family
  • ( PF00225 ) Kinesin motor domain
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF07106 ) Tat binding protein 1(TBP-1)-interacting protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00633600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15831.19.997093137033517e-262kinesin motor domain-containin
g protein (933 aa)
OxytrichaContig8328.0.g406.000287828677204e-80Kinesin motor domain
DictyBaseDDB_G02763694.0018838296491823e-56kif5 on chromosome: 2 position
6648064 to 6651339
WormBaseWBGene000038842.000065869309806e-55locus:osm-3 Osmotic avoidanc
e abnormal protein 3 status:
Confirmed UniProt:P46873 p
rotein_id:CCD70204.1
SGDYGL216W8.99567666834855e-44KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning
Stentor CoeruleusSteCoe_365325.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00633600(coding)
ATGAACAGATAAAATAAGTTTAATTTGTAAAATCAGCAATAATAATTTTAATAAAACTGG
CGATATAATGAGAGTGATGAAGAAGGAATGTATTATGAAGAATAGCAAAATGATATTGAA
TTTGAAAGGTAAAGTCCTTTAGCGTATAATAACTACAATACATTTAACAATTAGTAGTAA
AATTTAACTAATCAGTTTGAAAATTAAAATTAATATGATGAGGAATCTTTGATAATTGAA
AATCCTTTGGACTAGACACCTATTTAAGTCATGATAAGAGTTCGTCCATAATTTAATATT
GATTCATAATCAGCTTTAAAAATAGTAGATAATAATACAATTTATATCAACAACAATGAA
AATGTTCACTCATTCAAATATTCCAGGGTATTTAAACCAAGTGATAGCTAAGAAACTATT
TTTAAATATGTTTGTGAACCCATTCTTTAGCATGCTATCTAAGGTTACAATGCGTCTTTT
TTGGTTTATGGATAGACTGGAACAGGTAAAACACATACGATGGGTTTGCATCAAAACAAT
TTGTTAGAAGAACCTGGTATGATTTAGCATTCTTTAAAATTCTTGTTTGACCACTTTAAT
AACAGTCAACTAAACCCTGAAGATTGGTCTATCAGTTTGAATTTTATGCAAATATATATT
GAAGAGATTTTCGATTTACTAAATCCAAATGGATAAAAATTGTAAATTAGGGAGGACTCT
GAAAGCAACGAAGTTTATGTCTAAGATTTAATTACAGTTCCTATAAAAAATATCGATTAA
GCTATAAAATTAATTGAAGCTGGTTTAAATTAGAGAATGTTGGGTCCATAAAATATGAAT
TAATATTCTAGTAGATCTCATACAATTTTAAATGTTTACGTAAATCAAAGAATCTCATAT
AGTGAATACATTGTTTCAAATATAGCTTTTGTCGATTTAGCAGGTTCAGAAAGAATTAAG
AAATCAAATTCAACAGGAATAAGAATGGAGGAAGCTAAAAAGATTAATAGTAGTTTAAGT
GCTTTAAGCAATGTAATTTCATTATTGGGAAACTCTAATCAACAGTATATCCCTTATAGA
GATTCTAAGCTTACAAGAATTCTTTAAAATTGTTTGAATAGTCAAAGTAAAATATCAATT
ATTGGAACAGTTGAACCTTCTGAAGATAATAGCTTTGAAACCTACAGCACATTACTCTTT
GCTTCAAGATGTTAGGATATTTAATTTCTTCCTTAGTAAAACCTTCAAAATATCTTCACC
ATGAATAGCGATCCTTAAGAAGAAATTTAAAATTTAAAGGATTAAATCAAATATTATCAA
AGCAAAATTAAAAAAATGTCTTCTTCTATTTCTTCTGATGGGACTAAGTTTGCCAAATAA
ATAATTGAAACTCTGAAAAAACCATTTACTAAACTAGGAAGAAACTTAAAATAAGCTCAG
AAAATGAACGAGTAATTGCATTCTTAAATGAAAAACAAAAAAAATACCTCATATGAACCT
ATAGGGTTATATTAAGCTAAAATTCCTTTTGAGGAAATGATGTAAATGATCAGTGATGGC
AAGGAACAGGAATTCTTGAATTTGTTTGAATAAACTTTTGAAGATATTTTTTAAAAATAC
GGATAGATTTCTTTGGAATTAGAGAAATTAAAGGAAGTAAATTTAGCTAATTAAAACTAG
AAGACTGATGATCATCAGTAATTAACATCAAGCAGACCAAATACAAAATTGGCTACTGAA
TTAATAGAATATTATTCAGGTTTCAGTCAAACATTACTAAAATAATTGTTGGAATCAGAA
TAAATAGTAGATACAAATGATAGAGATCTATTAGAGAAAATTGGGGAATTCAATTAATAA
ACATAACTTAAACTAAAAGATATAGTAAAAAAACATAATATTAAAGAATTAATTTAGTAT
GTAGACACTTTGAATGAAACAAATTATGAAAAAATTGCTAAATCTGAGTCATACAGAGTT
AAATAGCTTGTCTTATAACTCAAGAAAAAAATAGAAGATACTGCTCAAAAAAATAATGAT
AAATCTAATACAAATATAAAAGACTTCTTAGAAAAGTAGAGACTTATAAATGAAAAAAAG
TTTATGATTAAATAGAGTGGAACACCTCTTAATAATTCATAAATTATAGGAGATAACAGC
AGTAGCATGAGCTTAAGAAGTAATTCAAGTAGTAATAATTTGACATAATAATAACAGCAA
CAACAATAATAATAAAATCAAGTAAATAACATCCCAAAAGGACCATCAAACTTAAAGCAG
ATGATGAATGATTTGAATTAAAAAAACAAGTAATAAACGAGCAATTCAGTAAATGAAAAT
TAAGAGAACTTTTCTTCATAGTAAGAAGGCTGTTATAATAGTAACAATATTAATAATAGC
TAAAGCAAAAAGTAAAGCTCAACTCCTATACATATATAAAGAGTGAAAATACTAAGTGAA
GATTAAATTGAAAAAAACCCATAAAATAACTTTGTAACAAATAAGCTCACAGAATAAAAT
ACAAATATTACTAAAACAGAAAAATAGAATATAAGTGAAAAGAAAATTGTTTAATAAGCC
AACTAAAATCTGAATAAAGAAATGTAATTTGATAGAAGTTCTAGTTCAGGCTCAAATAAA
ATAGATTATAACACAAATAGCTTATCTCCAATTCCATAAGAATAACAGTTGAATAGTCAA
TTAAAATCTTGTAATTTCTATAAAAAAAATTAAAAATACTCTCCTTTTACAGATAACTGA


>TTHERM_00633600(protein)
MNRQNKFNLQNQQQQFQQNWRYNESDEEGMYYEEQQNDIEFERQSPLAYNNYNTFNNQQQ
NLTNQFENQNQYDEESLIIENPLDQTPIQVMIRVRPQFNIDSQSALKIVDNNTIYINNNE
NVHSFKYSRVFKPSDSQETIFKYVCEPILQHAIQGYNASFLVYGQTGTGKTHTMGLHQNN
LLEEPGMIQHSLKFLFDHFNNSQLNPEDWSISLNFMQIYIEEIFDLLNPNGQKLQIREDS
ESNEVYVQDLITVPIKNIDQAIKLIEAGLNQRMLGPQNMNQYSSRSHTILNVYVNQRISY
SEYIVSNIAFVDLAGSERIKKSNSTGIRMEEAKKINSSLSALSNVISLLGNSNQQYIPYR
DSKLTRILQNCLNSQSKISIIGTVEPSEDNSFETYSTLLFASRCQDIQFLPQQNLQNIFT
MNSDPQEEIQNLKDQIKYYQSKIKKMSSSISSDGTKFAKQIIETLKKPFTKLGRNLKQAQ
KMNEQLHSQMKNKKNTSYEPIGLYQAKIPFEEMMQMISDGKEQEFLNLFEQTFEDIFQKY
GQISLELEKLKEVNLANQNQKTDDHQQLTSSRPNTKLATELIEYYSGFSQTLLKQLLESE
QIVDTNDRDLLEKIGEFNQQTQLKLKDIVKKHNIKELIQYVDTLNETNYEKIAKSESYRV
KQLVLQLKKKIEDTAQKNNDKSNTNIKDFLEKQRLINEKKFMIKQSGTPLNNSQIIGDNS
SSMSLRSNSSSNNLTQQQQQQQQQQNQVNNIPKGPSNLKQMMNDLNQKNKQQTSNSVNEN
QENFSSQQEGCYNSNNINNSQSKKQSSTPIHIQRVKILSEDQIEKNPQNNFVTNKLTEQN
TNITKTEKQNISEKKIVQQANQNLNKEMQFDRSSSSGSNKIDYNTNSLSPIPQEQQLNSQ
LKSCNFYKKNQKYSPFTDN


>TTHERM_00633600(gene)
ATTTATTAATTAATATTGATAGCAGCCTAACATAACTAGCAAGCAAGCAAACAAACAAAT
AAGCACAATTATTCTAGATATAAAAAGTTATTCAAAAGCAAACAAATAATAAATATATAC
ATCATGAACAGATAAAATAAGTTTAATTTGTAAAATCAGCAATAATAATTTTAATAAAAC
TGGCGATATAATGAGAGTGATGAAGAAGGAATGTATTATGAAGAATAGCAAAATGATATT
GAATTTGAAAGGTAAAGTCCTTTAGCGTATAATAACTACAATACATTTAACAATTAGTAG
TAAAATTTAACTAATCAGTTTGAAAATTAAAATTAATATGATGAGGAATCTTTGATAATT
GAAAATCCTTTGGACTAGACACCTATTTAAGTCATGATAAGAGTTCGTCCATAATTTAAT
ATTGATTCATAATCAGCTTTAAAAATAGTAGATAATAATACAATTTATATCAACAACAAT
GAAAATGTTCACTCATTCAAATATTCCAGGGTATTTAAACCAAGTGATAGCTAAGAAACT
ATTTTTAAATATGTTTGTGAACCCATTCTTTAGCATGCTATCTAAGGTTACAATGCGTCT
TTTTTGGTTTATGGATAGACTGGAACAGGTAGAGATATATATATATATATTACTATATTA
ACCTTAATCATATATTTTTAGAGAATATTTACTAAATTACTCAAAAAAAAAGCTTCAGGA
ATCTTAGAAAATTATAATAAGCAAGATAACTTAGCATTATTTAAAAAAGTTAAAACCAAA
TTATTTCCTCCCTACACAATAAAAAAATCATATTACAAAATATTTCAAAGAGCATTTCGA
GTCTGTCTTAATAATTAAGCAAAAGCAATTATATTTGGTGTGTAACTAATTGACAATATC
ATAAACGAATAAGTTAAATAATGCTAATTCAAAATAAAACTATTATTTTATGATGATCAT
GCTTGATTTTTATTATGCTGTTCAAATGCATATTAATAAATTACTTTTAGATTTAGTTCA
GAGTTATGTGATATATTTATTAAATTATTAATTTTCAAAAAGCTCTATTAATAAACAATA
ATCTGTCTTTTTATCTAGAATAGAGTTTACTTTATTTATCAACAAAATATGATTTAAAAC
TAGAATAATTAATTTTGTTTCATTAAGTAATTATAATAAAAGCAATCAACAATACTGTAG
TTTAGTAGGAATATTGTGTTGTTTTATGACAAAAATTAATTCATCAATAGTTATTCTTTG
ATCATTGAATAATTTTATTTATGATTTTTATAAATTATTACAAATTTATCAAATAGGTAA
AACACATACGATGGGTTTGCATCAAAACAATTTGTTAGAAGAACCTGGTATGATTTAGCA
TTCTTTAAAATTCTTGTTTGACCACTTTAATAACAGTCAACTAAACCCTGAAGATTGGTA
ATAAATTAATTTTTATTGTAACAATATTTATATTTTTTATTTATTAAATAGGTCTATCAG
TTTGAATTTTATGCAAATATATATTGAAGAGATTTTCGATTTACTAAATCCAAATGGATA
AAAATTGTAAATTAGGGAGGACTCTGAAAGCAACGAAGTTTATGTCTAAGATTTAATTAC
AGTTCCTATAAAAAATATCGATTAAGCTATAAAATTAATTGAAGCTGGTTTAAATTAGAG
AATGTTGGGTCCATAAAATATGAATTAATATTCTAGTAGATCTCATACAATTTTAAATGT
TTACGTAAATCAAAGAATCTCATATAGTGAATACATTGTTTCAAATATAGCTTTTGTCGA
TTTAGCAGGTTCAGAAAGAATTAAGAAATCAAATTCAACGTAAATCAATAAAAGCTATTA
GTTATATTTATCATAAGTAAAATGAATTTTATATTAATTAAAAAGAGGAATAAGAATGGA
GGAAGCTAAAAAGATTAATAGTAGTTTAAGTGCTTTAAGCAATGTAATTTCATTATTGGG
AAACTCTAATCAACAGTATATCCCTTATAGAGATTCTAAGCTTACAAGAATTCTTTAAAA
TTGTTTGAATAGTCAAAGTAAAATATCAATTATTGGAACAGTTGAACCTTCTGAAGATAA
TAGCTTTGAAACCTACAGCACATTACTCTTTGCTTCAAGATGTTAGGATATTTAATTTCT
TCCTTAGTAAAACCTTCAAAATATCTTCACCATGAATAGCGATCCTTAAGAAGAAATTTA
AAATTTAAAGGATTAAATCAAATATTATCAAAGCAAAATTAAAAAAATGTCTTCTTCTAT
TTCTTCTGATGGGACTAAGTTTGCCAAATAAATAATTGAAACTCTGAAAAAACCATTTAC
TGTAAATAAATTTTAAAAAATAATCATTCAAATATAATTTTTTTCATTTAGAAACTAGGA
AGAAACTTAAAATAAGCTCAGAAAATGAACGAGTAATTGCATTCTTAAATGAAAAACAAA
AAAAATACCTCATGTAATTCATTCAAACTTTCATTTTTATTATTTTAAAATGTTGAATAA
ATTAAATGAGTAAAAAAGTAAGTAAATTAATAAATAAATAAAGAAATAATTTTGAAAAGC
ACAAAATCAAAATACTTAGTAAATCTTAAAATTAAGTTTTATTTGATTAAGAAAAGTTTG
AAGAACTTTCATTATTTATTTATCAACACTTAACTTTGAAAGAAAAAATTATTTTTATAA
ACAAAAAATAAATAAGGAAAAATATTATTTATCTATTTGTTCAAGTTTGTAAGGCATTAT
TAAGTGAATGAATATAATAAAGATTTGGTTAAAATAAAATCTAATAAAATAGAAAATTAG
CCTTTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTTGAATATTTAA
ATTAATTTCTATTTTAAGATGAACCTATAGGGTTATATTAAGCTAAAATTCCTTTTGAGG
AAATGATGTAAATGATCAGTGATGGCAAGGAACAGGAATTCTTGAATTTGTTTGAATAAA
CTTTTGAAGATATTTTTTAAAAATACGGATAGATTTCTTTGGAATTAGAGAAGTAAATTG
TTCGTTTTGATATATTTTAAAAACTATTTTTTTAAAGATTAAAGGAAGTAAATTTAGCTA
ATTAAAACTAGAAGACTGATGATCATCAGTAATTAACATCAAGCAGACCAAATACAAAAT
TGGCTACTGAATTAATAGAATATTATTCAGGTTTCAGTCAAACATTACTAAAATAATTGT
TGGAATCAGAATAAATAGTAGATACAAATGATAGAGATCTATTAGAGAAAATTGGGGAAT
TCAATTAATAAACATAACTTAAACTAAAAGATATAGTAAAAAAACATAATATTAAAGAAT
TAATTTAGTATGTAGACACTTTGAATGAAACAAATTATGAAAAAATTGCTAAATCTGAGT
CATACAGAGTTAAATAGCTTGTCTTATAACTCAAGAAAAAAATAGAAGATACTGCTCAAA
AAAATAATGATAAATCTAATACAAATATAAAAGACTTCTTAGAAAAGTAGAGACTTATAA
ATGAAAAAAAGTTTATGATTAAATAGAGTGGAACACCTCTTAATAATTCATAAATTATAG
GAGATAACAGCAGTAGCATGAGCTTAAGAAGTAATTCAAGTAGTAATAATTTGACATAAT
AATAACAGCAACAACAATAATAATAAAATCAAGTAAATAACATCCCAAAAGGACCATCAA
ACTTAAAGCAGATGATGAATGATTTGAATTAAAAAAACAAGTAATAAACGAGCAATTCAG
TAAATGAAAATTAAGAGAACTTTTCTTCATAGTAAGAAGGCTGTTATAATAGTAACAATA
TTAATAATAGCTAAAGCAAAAAGTAAAGCTCAACTCCTATACATATATAAAGAGTGAAAA
TACTAAGTGAAGATTAAATTGAAAAAAACCCATAAAATAACTTTGTAACAAATAAGCTCA
CAGAATAAAATACAAATATTACTAAAACAGAAAAATAGAATATAAGTGAAAAGAAAATTG
TTTAATAAGCCAACTAAAATCTGAATAAAGAAATGTAATTTGATAGAAGTTCTAGTTCAG
GCTCAAATAAAATAGATTATAACACAAATAGCTTATCTCCAATTCCATAAGAATAACAGT
TGAATAGTCAATTAAAATCTTGTAATTTCTATAAAAAAAATTAAAAATACTCTCCTTTTA
CAGATAACTGA