Identifiers and Description

Gene Model Identifier

TTHERM_00564430

Standard Name

KIN142 (KINesin)

Aliases

PreTt08981 | 75.m00179 | 3721.m00061

Description

Kinesin motor domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00225 ) Kinesin motor domain
  • ( PF00038 ) Intermediate filament protein
  • ( PF02671 ) Paired amphipathic helix repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00564430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14595.19.997093137033517e-262kinesin motor domain-containin
g protein (629 aa)
SGDYPR141C9.999776257620412e-83KAR3 Minus-end-directed microt
ubule motor that functions in
mitosis and meiosis, localizes
to the spindle pole body and
localization is dependent on f
unctional Cik1p, required for
nuclear fusion during mating;
potential Cdc28p substrate
DictyBaseDDB_G02673966.00277790667473e-79kif2 on chromosome: 1 position
351991 to 354465
OxytrichaContig17786.0.g871.0002012508493003e-67Kinesin motor domain
WormBaseWBGene000022166.001629673589058e-65locus:klp-3 Kinesin-like pro
tein klp-3 status:Partially_
confirmed UniProt:P45962 p
rotein_id:CAA85331.1
Stentor CoeruleusSteCoe_371195.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27595611: Kushida Y, Takaine M, Nakano K, Sugai T, Vasudevan KK, Guha M, Jiang YY, Gaertig J, Numata O (2016) Kinesin-14 is Important for Chromosome Segregation During Mitosis and Meiosis in the Ciliate Tetrahymena thermophila. The Journal of eukaryotic microbiology ( ):

Sequences

>TTHERM_00564430(coding)
ATGTTTAATCACCAAACTCTTTTCGAGACAACTTAATTTTATGTTTAAAGATAAAATCTG
GCTGTTAATCCTCGTATAGCAGCTCTTAGAGAGAGACATGATATGATGAATAGCATAATA
AATGAACTTAATTAATCTAGCAAAAACGATTTGAAAAGACACTTGTTGTTAACATCTGAT
AAAATAACAAATATATTTACTTAAATTTAAGCTGATAAGGAAAATGTAAATAGCATTAAT
TTACCGCTTTAAGCTGATACAAAAGATAATAAAAATGGTAGTAATTTTAAAAGAAAAAGT
GATGAATAATCATTAGGATTACCTTCTACTGTCAATCAAAATTTTAATTTTTAATAGCCT
TTGATATCAAGTAATAACTTGAGACAGGCAGTATTTAAACCTGGAGCAGATATGCAAGAT
TTAGTTGATTAAAACATGATTCTTGAATAACTGTGCTAAAATTAAGAACATTTTTTAAAG
GAATTATATGAAGAAGCAGAAAATATTGCAAACAGTAATCTAATATGGAAAAAAGAAATT
ATACAAATGAATAATCACATAGCAAACATCGATAAAACTATTTCAAACTTGGAATGTAAT
TTTGTAAGCGAAGTAAAAGCAGTTAAAAATCAGGTTATGAATCTCCATATAACGAGCGAT
CAACTTTAAGAAGAGATGGATATTGAATTTGAAAACAACTAAAATCTAATGGAATAAAAT
TAAAAATATTCATAAGAGCTAAGTTAACTGCTTGAAATAAAAAAACAACTAGAAAAAGAA
ATAGAAGAAACAGAAATGCACTAAAAATCACTGAAGGAACAAAATAATTAATTTTCTGAT
TTTTTAGCTACAAGCGAAATAAAATAATAAGAGTTATTTTAACGAATTGAGCTCACTGTT
GCAGAAAAAAAGGACTTAAATGATGAATTATAATCAATAAAAGGTAACATTAGAGTATAT
TGCAGAATTAGACCTCTTTTACCTTCTGAAATAAATGTTGAAAAATGTACTAATATTATT
TAAGTAACGTCTAGTAATAATGTAGCACTTTAAGTTCCTTAACAACACTTAAAATCAGAA
AATAATTAGAAAGATTACAGATTTTCTTTTGAATAAATATTTGATGAAAACTCTTCTTAG
CAGACAGTGTTTGCTGAAATGTCTTAATTAATACAATCACTGATTGATGGATTTAATGTA
TGTATTTTTGCTTATGGTTAGACAGGCTCTGGAAAGACATATACAATTGAAGGTGGGTAA
AGCGAAGAGTCTAAAGGTCTTATGCAAAGATCTATGGAAATGATATTTCAACAAATAAAA
TATTTACAGTAATTTGGTTGGACCTATAAATTATTTGTAAGCTTTTAAGAGGTTTACATG
GAGCAGCATAGAGATCTCATTACTAACTTCAAAGTAAGCGAAAAGCAGGATTAGCTCGTT
TTTGTTGAAATTAATTCAATTGAAGAATTTTATCCTCTCATGAAAAGAGCCAGAGAAAAT
AGAAAGACTGGCAGCACGATGTGCAATGATCATTCTTCTAGAAGTCACTCTATATTTTAA
TTAAAATTATATGGTTCCAACACTAAAGATGGAAAAACTTGCAATGGAACACTAAATTTA
GTTGACCTTGCAGGTTCTGAAAGAGTTACACAATCAAAAGCTGAAGGTTTGCTATTAGAA
GAAACTAAATTTATAAATAGAAGTCTAACTTCTTTGGGAGACGTCATTAATTCCTTGGCA
CAAAAAGATAAGCACACACCTTTTCGAAATTCAAAATTAACATATTTACTGCAACCATAT
TTATCAGGAGAAGGATCAAAGACATTAATGTTTTTAAATTTATCCCCATCTTCTTCTAGC
TATCATCAAACATTATGTAGTCTAAGATTTGGTGATAAAGTTTCAAATATAAAGCTTAAA
AAAAAGTGA


>TTHERM_00564430(protein)
MFNHQTLFETTQFYVQRQNLAVNPRIAALRERHDMMNSIINELNQSSKNDLKRHLLLTSD
KITNIFTQIQADKENVNSINLPLQADTKDNKNGSNFKRKSDEQSLGLPSTVNQNFNFQQP
LISSNNLRQAVFKPGADMQDLVDQNMILEQLCQNQEHFLKELYEEAENIANSNLIWKKEI
IQMNNHIANIDKTISNLECNFVSEVKAVKNQVMNLHITSDQLQEEMDIEFENNQNLMEQN
QKYSQELSQLLEIKKQLEKEIEETEMHQKSLKEQNNQFSDFLATSEIKQQELFQRIELTV
AEKKDLNDELQSIKGNIRVYCRIRPLLPSEINVEKCTNIIQVTSSNNVALQVPQQHLKSE
NNQKDYRFSFEQIFDENSSQQTVFAEMSQLIQSLIDGFNVCIFAYGQTGSGKTYTIEGGQ
SEESKGLMQRSMEMIFQQIKYLQQFGWTYKLFVSFQEVYMEQHRDLITNFKVSEKQDQLV
FVEINSIEEFYPLMKRARENRKTGSTMCNDHSSRSHSIFQLKLYGSNTKDGKTCNGTLNL
VDLAGSERVTQSKAEGLLLEETKFINRSLTSLGDVINSLAQKDKHTPFRNSKLTYLLQPY
LSGEGSKTLMFLNLSPSSSSYHQTLCSLRFGDKVSNIKLKKK


>TTHERM_00564430(gene)
ATGTTTAATCACCAAACTCTTTTCGAGACAACTTAATTTTATGTTTAAAGATAAAATCTG
GCTGTTAATCCTCGTATAGCAGCTCTTAGAGAGAGACATGATATGATGAATAGCATAATA
AATGAACTTAATTAATCTAGCAAAAACGATTTGAAAAGACACTTGTTGTTAACATCTGAT
AAAATAACAAATATATTTACTTAAATTTAAGCTGATAAGGAAAATGTAAATAGCATTAAT
TTACCGCTTTAAGCTGATACAAAAGATAATAAAAATGGTAGTAATTTTAAAAGAAAAAGT
GATGAATAATCATTAGGATTACCTTCTACTGTCAATCAAAATTTTAATTTTTAATAGCCT
TTGATATCAAGTAATAACTTGAGACAGGCAGTATTTAAACCTGGAGCAGATATGCAAGAT
TTAGTTGATTAAAACATGATTCTTGAATAACTGTGCTAAAATTAAGAACATTTTTGTATA
TTTATTTATATAGCTAAGCAATTTCTTAAAAAAATTTTAAATTAGTAAAGGAATTATATG
AAGAAGCAGAAAATATTGCAAACAGTAATCTAATATGGAAAAAAGAAATTATACAAATGA
ATAATCACATAGCAAACATCGATAAAACTATTTCAGTAAATTATATCAAAAGCTCATAAA
TTATTTTTTTATACCTTTTGTTTTTATTAGAACTTGGAATGTAATTTTGTAAGCGAAGTA
AAAGCAGTTAAAAATCAGGTTATGAATCTCCATATAACGAGCGATCAACTTTAAGAAGAG
ATGGATATTGAATTTGAAAACAACTAAAATCTAATGGAATAAAATTAAAAATATTCATAA
GAGCTAAGTTAACTGCTTGAAATAAAAAAACAACTAGAAAAAGAAATAGAAGAAACAGAA
ATGCACTAAAAATCACTGAAGGAACAAAATAATTAATTTTCTGATTTTTTAGCTACAAGC
GAAATAAAATAATAAGAGTTATTTTAACGAATTGAGCTCACTGTTGCAGAAAAAAAGGAC
TTAAATGATGAATTATAATCAATAAAAGGTAACATTAGAGTATATTGCAGAATTAGACCT
CTTTTACCTTCTGAAATAAATGTTGAAAAATGTACTAATATTATTTAAGTAACGTCTAGT
AATAATGTAGCACTTTAAGTTCCTTAACAAGTAGCTATTAAATTTAATGCCTAGATATTA
ATTTTTCATTTTTATTAAAATAAAAAAAGCACTTAAAATCAGAAAATAATTAGAAAGATT
ACAGATTTTCTTTTGAATAAATATTTGATGAAAACTCTTCTTAGCAGACAGTGTTTGCTG
AAATGTCTTAATTAATACAATCACTGATTGATGGATTTAATGTATGTATTTTTGCTTATG
GTTAGACAGGCTCTGGAAAGACATATACAATTGAAGGTGGGTAAAGCGAAGAGTCTAAAG
GTCTTATGCAAAGATCTATGGAAATGATATTTCAACAAATAAAATATTTACAGTAATTTG
GTTGGACCTATAAATTATTTGTAAGCTTTTAAGAGGTAATGAATAACAATTGATTATATA
AATTATTTATTAATTTTATTTTCATTAATTTAGGTTTACATGGAGCAGCATAGAGATCTC
ATTACTAACTTCAAAGTAAGCGAAAAGCAGGATTAGCTCGTTTTTGTTGAAATTAATTCA
ATTGAAGAATTTTATCCTCTCATGAAAAGAGCCAGAGAAAATAGAAAGACTGGCAGCACG
ATGTGCAATGATCATTCTTCTAGAAGTCACTCTATATTTTAATTAAAATTATATGGTTCC
AACACTAAAGATGGAAAAACTTGCAATGGAACACTAAATTTAGTTGACCTTGCAGGTTCT
GAAAGAGTTACACAATCAAAAGCTGAAGGTTTGCTATTAGAAGAAACTAAATTTATAAAT
AGAAGTCTAACTTCTTTGGGAGACGTCATTAATTCCTTGGCACAAAAAGATAAGCACACA
CCTTTTCGAAATTCAAAATTAACATATTTACTGCAACCATATTTATCAGGTATTTATTTT
CAAGACTATATGAGTAATTATTTATAATTTTTTATTTTAAATAAAAAGGAGAAGGATCAA
AGACATTAATGTTTTTAAATTTATCCCCATCTTCTTCTAGCTATCATCAAACATTATGTA
GTCTAAGATTTGGTGATAAAGTTTCAAATATAAAGCTTAAAAAAAAGTGA