Identifiers and Description

Gene Model Identifier

TTHERM_00115410

Standard Name

KIN141 (KINesin)

Aliases

PreTt27157 | 8.m00417 | 3812.m02450

Description

Kinesin motor domain containing protein; localizes at the mitotic and meiotic spindle microtubules near poles; essential for the mitotic and meiotic chromosome segregation; contributes the shortening of meiotic crescent

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00115410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03889.19.997093137033517e-262kinesin motor domain-containin
g protein (634 aa)
OxytrichaContig17786.0.g873.999031314999233e-77Kinesin motor domain
SGDYPR141C4.99966753182923e-69KAR3 Minus-end-directed microt
ubule motor that functions in
mitosis and meiosis, localizes
to the spindle pole body and
localization is dependent on f
unctional Cik1p, required for
nuclear fusion during mating;
potential Cdc28p substrate
DictyBaseDDB_G02673964.998816730869543e-67kif2 on chromosome: 1 position
351991 to 354465
WormBaseWBGene000022222.000555387360374e-52locus:klp-11 status:Partiall
y_confirmed UniProt:Q19633
protein_id:CAA92295.2
Stentor CoeruleusSteCoe_371191.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27595611: Kushida Y, Takaine M, Nakano K, Sugai T, Vasudevan KK, Guha M, Jiang YY, Gaertig J, Numata O (2017) Kinesin-14 is Important for Chromosome Segregation During Mitosis and Meiosis in the Ciliate Tetrahymena thermophila. The Journal of eukaryotic microbiology 64(3):293-307

Sequences

>TTHERM_00115410(coding)
ATGGATAGATCATTTTTTTTATAAAATAGAAGCCCGTATTAATCTAAAAGTGCTGGAAAA
TATAGAAACGATGAGGATTTAGCTTTCGAAGATTATTACACAGATGATTTCAGTAATGAG
GAATATATAAAGGAATATTAGTAGTAAAATGCCTACTTAAATAAAATGGTTAAACAAAGG
ATCATTTTTTTAGAAGAGCTGTAATAATAAGAAAATATTTAGGAAGAAAAAAGAAAGCAA
CTACAAATGAATCTTGCTATTTCGAAATCAAAAGTTTAAGGAGTTGATTCAGATTTACTA
AACTTAATATCAGAGTGTAAAAGCTTAGCTGAAGAAACCACTTCAAAATAAGACAAGTTG
TTACAAGATAAGACTAACCTATAAAAAAAGGAAGCTGAAACTTTGTCTTTGCTGAATCAT
CATAAATTCTCTCTTTAAAAAACAATAGAAAAGACCATGAATTATAAATAAATTTACTAA
AGTTTGGAAAAATAGTATTAATATTATAAAGAGAATTTATTATGTATAAATGAAAAATAA
AAATCTTTATAAGAAGAGATAAAGAGCATACAAGATGGGACTCATCTAGATGCATAACTT
TTGCAATTTACTCAATAAAAATAAAATTTAAATGAAAAACTTTAATCTATGAAAGGGAAT
ATTAGAGTGTATTGTAGGATCAGACCCTTAAGACAAGAAGAAAAGATAGCTATGCTTCAA
AATTCATTTAAAAAGCAATATGAAGAAAAACAATAAAATGTTTAAAATCCTAAAATAACT
CCATTGAGCAAAGCTAGTGTATAAAAAGGCAGTGTTGGTAAAGTAGAAAATATAAAAGGA
GTGGGATCTGTGGGTAAAATTGATGAGAACAACCCAAACTTTTAACAAGAAATGCAAATT
TATGTTTAAAATATGCTTGATATCATAAAGGACGATGATAACCTTCTTTATTAAATGACA
CAATAAAATAGAATTATAAAAACATAAAATTCTTAAAATTTAAAGTTGGTTGTTCCTTTC
TAAAACATGAAATCAGAAAATAACATCAAAGAATACAGTTTTAAATTAGAACATATTTTT
GAAGAAGATGCCACATAAATGGAAGTCTTTTCCAACTTGCAAGAATTGATTTAATCTGTG
TTAGATGGCTACAATGTTTGTATATTTGCTTATGGGCCTACAGGCAGTGGGAAAACTTAC
ACTATGTAAGGAGAAGAAGATTATAATAAATGGGGAATAATACCTCGCTCAATAGAGTAC
ATTTATTCAGAAATTGAAAAGATGTAAAGCTATGGCTGGGAACATAAAATAAAAATCTAA
TTCAGTGAGATATACAATGAGACTTTAATAGATCTCTTACATCCTGATGGAAAAAAAGAT
GAAGTATAGGATAAAGTAATTACTTAAGGCCCAGAAGAAATAATGAAGCTTTTATAAAAA
GGCTATATCTCTCGTAAAGTAGCATCTACTGATTGCAACGAATACAGTTCAAGATCACAT
TCTATTTTTAGAATGAACTTAGATATCTATAATACCTAAAAGCAGGGGAAGAATCCTTAG
CAACCGCTTCTTAAGGGAAGTCTGAACTTAGTTGATTTGGCTGGGTCAGAAAGAATTAAT
TAATCAAATGTTGCAGGTGAAAGATTAAAAGAAACCTAAAATATTAATAAAAGTTTAACT
TCTTTGGCAGCTGTGATAACAAGTCTAGCCAAAAAGGAAACATTCACGGCTTTCAGAAAT
TCAAAATTGACTTATTATCTCCATGAGTATTTAGGTGGTAAATCAAAAACTCTCATGATG
GTAAACATATCACCAGCCCCATCTTCATTTTATCCTACACTTACTACTTTAAGATTTGCT
GATTAAGCTAAATAGTGTTAAAATAAAACTGAATAAAATACAATTGGAATTTCGTAAAGT
TAAAGGTCAATTTCACCCATGAATAATCAAGGAAAATAAAGCTTATAAAAGAATGTAATA
TCTACACCTAGTAAAGGTGGAAGATTCTAAAATATTCTTGCTTAATCTAGTATTAGAAAC
ACTATTCTTAATTCTGTTAAGAAATGA


>TTHERM_00115410(protein)
MDRSFFLQNRSPYQSKSAGKYRNDEDLAFEDYYTDDFSNEEYIKEYQQQNAYLNKMVKQR
IIFLEELQQQENIQEEKRKQLQMNLAISKSKVQGVDSDLLNLISECKSLAEETTSKQDKL
LQDKTNLQKKEAETLSLLNHHKFSLQKTIEKTMNYKQIYQSLEKQYQYYKENLLCINEKQ
KSLQEEIKSIQDGTHLDAQLLQFTQQKQNLNEKLQSMKGNIRVYCRIRPLRQEEKIAMLQ
NSFKKQYEEKQQNVQNPKITPLSKASVQKGSVGKVENIKGVGSVGKIDENNPNFQQEMQI
YVQNMLDIIKDDDNLLYQMTQQNRIIKTQNSQNLKLVVPFQNMKSENNIKEYSFKLEHIF
EEDATQMEVFSNLQELIQSVLDGYNVCIFAYGPTGSGKTYTMQGEEDYNKWGIIPRSIEY
IYSEIEKMQSYGWEHKIKIQFSEIYNETLIDLLHPDGKKDEVQDKVITQGPEEIMKLLQK
GYISRKVASTDCNEYSSRSHSIFRMNLDIYNTQKQGKNPQQPLLKGSLNLVDLAGSERIN
QSNVAGERLKETQNINKSLTSLAAVITSLAKKETFTAFRNSKLTYYLHEYLGGKSKTLMM
VNISPAPSSFYPTLTTLRFADQAKQCQNKTEQNTIGISQSQRSISPMNNQGKQSLQKNVI
STPSKGGRFQNILAQSSIRNTILNSVKK


>TTHERM_00115410(gene)
ATGGATAGATCATTTTTTTTATAAAATAGAAGCCCGTGTAAAAACAATTTTATTTAAGAG
AAAGAGGACTTGTAAAAAGTAGTTAATAATTTTTAATAAAATAGATTAATCTAAAAGTGC
TGGAAAATATAGAAACGATGAGGATTTAGCTTTCGAAGATTATTACACAGATGATTTCAG
TAATGAGGAATATATAAAGGAATATTAGTAGTAAAATGCCTACTTAAATAAAATGGTTAA
ACAAAGGATCATTTTTTTAGAAGAGCTGTAATAATAAGAAAATATTTAGGAAGAAAAAAG
AAAGCAACTACAAATGAATCTTGCTATTTCGAAATCAAAAGTTTAAGGAGTTGATTCAGA
TTTACTAAACTTAATATCAGAGTGTAAAAGCTTAGCTGAAGAAACCACTTCAAAATAAGA
CAAGTTGTTACAAGATAAGACTAACCTATAAAAAAAGGAAGCTGAAACTTTGTCTTTGCT
GAATCATCATAAATTCTCTCTTTAAAAAACAATAGAAAAGACCATGAATTATAAATAAAT
TTACTAAAGTTTGGAAAAATAGTATTAATATTATAAAGAGAATTTATTATGTATAAATGA
AAAATAAAAATCTTTATAAGAAGAGATAAAGAGCATACAAGATGGGACTCATCTAGATGC
ATAACTTTTGCAATTTACTCAATAAAAATAAAATTTAAATGAAAAACTTTAATCTATGAA
AGGGAATATTAGAGTGTATTGTAGGATCAGACCCTTAAGACAAGAAGAAAAGATAGCTAT
GCTTCAAAATTCATTTAAAAAGCAATATGAAGAAAAACAATAAAATGTTTAAAATCCTAA
AATAACTCCATTGAGCAAAGCTAGTGTATAAAAAGGCAGTGTTGGTAAAGTAGAAAATAT
AAAAGGAGTGGGATCTGTGGGTAAAATTGATGAGAACAACCCAAACTTTTAACAAGAAAT
GCAAATTTATGTTTAAAATATGCTTGATATCATAAAGGACGATGATAACCTTCTTTATTA
AATGACACAATAAAATAGAATTATAAAAACATAAAATTCTTAAAATTTAAAGTTGGTTGT
TCCTTTCTAAAACATGAAATCAGAAAATAACATCAAAGAATACAGTTTTAAATTAGAACA
TATTTTTGAAGAAGATGCCACATAAATGGAAGTCTTTTCCAACTTGCAAGAATTGATTTA
ATCTGTGTTAGATGGGTTAATAATTTTATATATTATTACTATTTTTTAACAAAACTATTC
ATAAAATTAGCTACAATGTTTGTATATTTGCTTATGGGCCTACAGGCAGTGGGAAAACTT
ACACTATGTAAGGAGAAGAAGATTATAATAAATGGGGAATAATACCTCGCTCAATAGAGT
ACATTTATTCAGAAATTGAAAAGATGTAAAGCTATGGCTGGGAACATAAAATAAAAATCT
AATTCAGTGAGATATACAATGAGACTTTAATAGATCTCTTACATCCTGATGGAAAAAAAG
ATGAAGTATAGGATAAAGTAATTACTTAAGGCCCAGAAGAAATAATGAAGCTTTTATAAA
AAGGCTATATCTCTCGTAAAGTAGCATCTACTGATTGCAACGAATACAGTTCAAGATCAC
ATTCTATTTTTAGAATGAACTTAGATATCTATAATACCTAAAAGCAGGGGAAGAATCCTT
AGCAACCGCTTCTTAAGGGAAGTCTGAACTTAGTTGATTTGGCTGGTAAAATTATTATTT
TTTTGTAAGTTTTTATTTTGAACAGAAAACAATTCTGATTTATGGAAATTTATTTGCAAA
AAAACATAATGCAATTTATAATTTTGATAAATAAATGAATAAAATGAATAGGGTCAGAAA
GAATTAATTAATCAAATGTTGCAGGTGAAAGATTAAAAGAAACCTAAAATATTAATAAAA
GTTTAACTTCTTTGGCAGCTGTGATAACAAGTCTAGCCAAAAAGGAAACATTCACGGCTT
TCAGAAATTCAAAATTGACTTATTATCTCCATGAGTATTTAGGTGGTAAATCAAAAACTC
TCATGATGGTAAACATATCACCAGCCCCATCTTCATTTTATCCTACACTTACTACTTTAA
GATTTGCTGATTAAGCTAAATAGTGTTAAAATAAAACTGAATAAAATACAATTGGAATTT
CGTAAAGTTAAAGGTCAATTTCACCCATGAATAATCAAGGAAAATAAAGCTTATAAAAGA
ATGTAATATCTACACCTAGTAAAGGTGGAAGATTCTAAAATATTCTTGCTTAATCTAGTA
TTAGAAACACTATTCTTAATTCTGTTAAGAAATGA