Identifiers and Description

Gene Model Identifier

TTHERM_00456900

Standard Name

KHD5 (KH domain-containing protein 5)

Aliases

PreTt20320 | 53.m00222 | 3712.m00082

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00456900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13784.17.00307292561241e-151hypothetical protein (233 aa)
OxytrichaContig17338.0.g954.001839059848271e-97KH domain
SGDYOR145C6.002330506118426e-84PNO1 Essential nucleolar prote
in required for pre-18S rRNA p
rocessing, interacts with Dim1
p, an 18S rRNA dimethyltransfe
rase, and also with Nob1p, whi
ch is involved in proteasome b
iogenesis; contains a KH domai
n
DictyBaseDDB_G02875571.9996609186508915e-82pno1 on chromosome: 5 position
417964 to 419093
WormBaseWBGene000131441.999618694399617e-70RNA-binding protein pno-1 st
atus:Confirmed UniProt:O1821
6 protein_id:CAB16491.1
Stentor CoeruleusSteCoe_194831.6458114310822737e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00456900(coding)
ATGGATAACCAAGAAGAAGTTCAATTCGATTAAAACGAAGAAATAGATCAAGAATTCGAT
AAGATAGATGAATAAGATATCGTATTAGAAAAGATTGATGAGTTCGCTAAAGATATTGAT
TTTGAAAAACCTGAAGAAGCAGCTAAAAAGAGTGAAATGAGAAGAATTCCAGTACCTCCT
CACAGATTAACTCCATTAAGATAAAGTTGGGAAAAGATTGTTACTACTGTTGTAGAAAAT
ATGAAATTATAAATCAGAATGAACACCAAAAAGAAAGCTGTTGAAATTAAATCATCAGAA
CACACACCTGAAACCTCTGCCGTACAAAAGACTGCTGATTTCTTAAAGGCTTTCATGCTT
GGTTTCGAATTAAATGATGCTATTGCTTTACTAAGATTAGATGATTTATATATTGAATCT
TTTGAAGTTAAGGATGTTAAAAATTTAAGTGGTGATAACTTGTCTCGTGCCATTGGTAGA
ATTACTGGTGAAAAAGGTAAAACTAAGTTTGCTATAGAGAATGCATCAAGAACAAGAATC
GTAGTTGCTGATAAAAAGATTCACATATTAGGTTCATTCAGTAATATAAAATGCGCTAGA
GAAGCTATCTGCTCCTTGATTATGGGTAGCCCACCTGGTAAAGTTTACTCTCAACTTAAA
TTCATTGCTAAAAGATACTTAGAAAAGTTTTGA


>TTHERM_00456900(protein)
MDNQEEVQFDQNEEIDQEFDKIDEQDIVLEKIDEFAKDIDFEKPEEAAKKSEMRRIPVPP
HRLTPLRQSWEKIVTTVVENMKLQIRMNTKKKAVEIKSSEHTPETSAVQKTADFLKAFML
GFELNDAIALLRLDDLYIESFEVKDVKNLSGDNLSRAIGRITGEKGKTKFAIENASRTRI
VVADKKIHILGSFSNIKCAREAICSLIMGSPPGKVYSQLKFIAKRYLEKF


>TTHERM_00456900(gene)
ATGGATAACCAAGAAGAAGTTCAATTCGATTAAAACGAAGAAATAGATCAAGAATTCGAT
AAGATAGATGAATAAGATATCGTATTAGAAAAGATTGATGAGTTCGCTAAAGATATTGAT
TTTGAAAAACCTGAAGAAGCAGTAATCATCTTTAACTTACTTATAATTAATAGTTACTAT
ACTGAATAAATACATAAATAATGTTAAAAATTTAATTTTCAACAAACAAAGTTGAATGCT
GTTTAAATTGAGAATTTTATTTCACATCATTTTGAAGCAAGGTTATTAAAAGCAATTTTA
TTATGAAAAAATAGGCTAAAAAGAGTGAAATGAGAAGAATTCCAGTACCTCCTCACAGAT
TAACTCCATTAAGATAAAGTTGGGAAAAGATTGTTACTACTGTTGTAGAAAATATGAAAT
TATAAATCAGAATGAACACCAAAAAGAAAGCTGTTGAAATTAAATCATCAGAACACACAC
CTGAAACCTCTGCCGTACAAAAGACTGCTGATTTCTTAAAGGCTTTCATGCTTGGTTTCG
AATTAAATGATGCTATTGCTTTACTAAGATTAGATGATTTATATATTGAATCTTTTGAAG
TTAAGGATGGTAATTAATATATTATTACCTATTTATTCAACACTGAGTCCTTTAAAATTT
TATATATAAGATGGACTTTTAAAATTTTGAAAACGTTTTTAAAATTAACTTAATTTTTAT
TATAAAAGTTAAAAATTTAAGTGGTGATAACTTGTCTCGTGCCATTGGTAGAATTACTGG
TGAAAAAGGTAAAACTAAGTTTGCTATAGAGAATGCATCAAGAACAAGAATCGTAGTTGC
TGATAAAAAGATTCACATATTAGGTATGATTTTTAGCATTAAAATTTTTGAAATAAAGAC
TAAATAAAATATCACTAAAATAAAAGGTTCATTCAGTAATATAAAATGCGCTAGAGAAGC
TATCTGCTCCTTGATTATGGGTAGCCCACCTGGTAAAGTTTACTCTCAACTTAAATTCAT
TGCTAAAAGATACTTAGAAAAGTTTTGA