Identifiers and Description

Gene Model Identifier

TTHERM_00420000

Standard Name

KHD4 (KH domain-containing protein 4)

Aliases

PreTt07125 | 46.m00180 | 3679.m00030

Description

KH domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00420000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11067.19.997093137033517e-262KH domain-containing protein (
551 aa)
OxytrichaContig17537.0.g931.999981404597394e-31KH domain
WormBaseWBGene000227380.0000000000019997478866288316status:Confirmed UniProt:Q23
487 protein_id:CCD61629.1
DictyBaseDDB_G02935540.000000005997038937208364sf1 on chromosome: 6 position
3035802 to 3037515
SGDYLR116W0.00000039992052383199455MSL5 Component of the commitme
nt complex, which defines the
first step in the splicing pat
hway; essential protein that i
nteracts with Mud2p and Prp40p
, forming a bridge between the
intron ends; also involved in
nuclear retention of pre-mRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420000(coding)
ATGGGCAGAAGAAGTCGTTCTAGGAGCAGAAGCAGAAGTAAAGATAAAAAGAAGGATAAG
CATTCATCCCACTCTTCATCCACTCGTGACCGCGAAAAGCAAAAGGAACTCGAGCGCAAA
GAGAAGGAAGCAAAAAAGAGGAGTAGATTTTCTGATGTTCCCCTCAATGATTCAACAGCA
TTTAGCAACAAGTTCTCCAGCAGTTTTAGTGGCAACGGATCTGGTGGCGCAAATTCATCA
TGGTAATAATAAAATTAGTAATATTCACCTAATAAAGAAGAAGGTCCCACAGACATCCAA
ACATTGATTGAGTAGGCCAAGCGTACTGCTTAGTTAAATGAAGCATTTGGCAAGGTTCCT
CAGGACAGGCCAATCTAAGACTTTGCTGCTGGGTCAGATCTTTTAGGTGGTCTTTCCATT
CCAGGCTTATCTATAGTGAATGGCGTAGGTATTAACACAACTCCTAAACCAGTCACTGCA
GCCTAGACTATTGTCAGAAATATAGATATCCCACAAGATAATAATTTCAACTATGTAGGT
CTGATACTTGGACCTAAGGGATCTAATCAAAAACGCATTTAGGAAAAAACACGCTGCAGG
ATTATTATAAAGTCAGATTAAATACCTCCTCATGTTTAAATAGCAGGTTCTTCAGAAAAA
GACGTAGCAGAAGCTTGTTGCGAAATAGAGCGTATTCTTTTCAGTGATGAAGAAACAAGA
AATAAGATTAAAAGCGAGTAGCTTAAGGAAGTAGCAGATATGAATAACTCAGTATAATAA
AACAGACTTGTCGTTAGGGTTCCACAGAATTTCGTTGGATTAATCCTCGGCAAGGGTGGT
GAAACTATTCGCTCCATTAAGACTCAATGTGGAGCAAGCTACATATAAATGGATTCTAAC
TAAGTTTAAGGAGAGGAATATAAGAATTTTACAGTTTTTGGTACTTAGGAATAGTGTGAA
AAGGCATAAAAATTAATTTTTGATTATATAGAATCTTACAAATCAAATTCAAAGAAAGAA
ATCTTTGAAGTACCAGTTGAATTAGTTGGAGGTTTTATTGGAAAGAGCGGATGCAACATA
CAAAATATAAATAAATCTAGTGGTGCCCGTTTGATAATGAACAACAATAATGAAACTGTT
AGAGGAAACAAGTTGTTCGAAATCGTCGGAAACGCACAACAGATTCAAAACGCCATCCAC
TTAGCTTAGAATTTATTAGATCAATTAAAAAGCACACATTAGGGATAATTTGGAGGCGGT
GCCGCCATGCAAGGTTACAACAATAACAACAGCAACTACCTTCCCAATGGCCAGAGAGAC
CCTAATGGTGGTCATGGAAGTAGCGAGAGAGGTGATGATCGTAACAGAAACGAACATTCT
CAATAAAATTATTATTAAGGCATGCAGCCATAATAGATGATGGGACAAGATCCATAGTAA
CTTTAATAGCATTATTAACAATAGCAGATGCTTATGTAACAATACTACTAGCAATAGCTT
TACTACCAATAATACTATCAGTAAATGGCAAATCCGCAAATAGAAGAAATTACTATTGAT
TAATCAAAGAGATGA


>TTHERM_00420000(protein)
MGRRSRSRSRSRSKDKKKDKHSSHSSSTRDREKQKELERKEKEAKKRSRFSDVPLNDSTA
FSNKFSSSFSGNGSGGANSSWQQQNQQYSPNKEEGPTDIQTLIEQAKRTAQLNEAFGKVP
QDRPIQDFAAGSDLLGGLSIPGLSIVNGVGINTTPKPVTAAQTIVRNIDIPQDNNFNYVG
LILGPKGSNQKRIQEKTRCRIIIKSDQIPPHVQIAGSSEKDVAEACCEIERILFSDEETR
NKIKSEQLKEVADMNNSVQQNRLVVRVPQNFVGLILGKGGETIRSIKTQCGASYIQMDSN
QVQGEEYKNFTVFGTQEQCEKAQKLIFDYIESYKSNSKKEIFEVPVELVGGFIGKSGCNI
QNINKSSGARLIMNNNNETVRGNKLFEIVGNAQQIQNAIHLAQNLLDQLKSTHQGQFGGG
AAMQGYNNNNSNYLPNGQRDPNGGHGSSERGDDRNRNEHSQQNYYQGMQPQQMMGQDPQQ
LQQHYQQQQMLMQQYYQQQLYYQQYYQQMANPQIEEITIDQSKR


>TTHERM_00420000(gene)
ATGGGCAGAAGAAGTCGTTCTAGGAGCAGAAGCAGAAGTAAAGATAAAAAGAAGGATAAG
CATTCATCCCACTCTTCATCCACTCGTGACCGCGAAAAGCAAAAGGAACTCGAGCGCAAA
GAGAAGGAAGCAAAAAAGAGGAGTAGATTTTCTGATGTTCCCCTCAATGATTCAACAGCA
TTTAGCAACAAGTTCTCCAGCAGTTTTAGTGGCAACGGATCTGGTGGCGCAAATTCATCA
TGGTAATAATAAAATTAGTAATATTCACCTAATAAAGAAGAAGGTCCCACAGACATCCAA
ACATTGATTGAGTAGGCCAAGCGTACTGCTTAGTTAAATGAAGCATTTGGCAAGGTTCCT
CAGGACAGGCCAATCTAAGACTTTGCTGCTGGGTCAGATCTTTTAGGTGGTCTTTCCATT
CCAGGCTTATCTATAGTGAATGGCGTAGGTATTAACACAACTCCTAAACCAGTCACTGCA
GCCTAGACTATTGTCAGAAATATAGATATCCCACAAGATAATAATTTCAACTATGTAGGT
CTGATACTTGGACCTAAGGGATCTAATCAAAAACGCATTTAGGAAAAAACACGCTGCAGG
ATTATTATAAAGTCAGATTAAATACCTCCTCATGTTTAAATAGCAGGTTCTTCAGAAAAA
GACGTAGCAGAAGCTTGTTGCGAAATAGAGCGTATTCTTTTCAGTGATGAAGAAACAAGA
AATAAGATTAAAAGCGAGTAGCTTAAGGAAGTAGCAGATATGAATAACTCAGTATAATAA
AACAGACTTGTCGTTAGGGTTCCACAGAATTTCGTTGGATTAATCCTCGGCAAGGGTGGT
GAAACTATTCGCTCCATTAAGACTCAATGTGGAGCAAGCTACATATAAATGGATTCTAAC
TAAGTTTAAGGAGAGGAATATAAGAATTTTACAGTTTTTGGTACTTAGGAATAGTGTGAA
AAGGCATAAAAATTAATTTTTGATTATATAGAATCTTACAAATCAAATTCAAAGAAAGAA
ATCTTTGAAGTACCAGTTGAATTAGTTGGAGGTTTTATTGGAAAGAGCGGATGCAACATA
CAAAATATAAATAAATCTAGTGGTGCCCGTTTGATAATGAACAACAATAATGAAACTGTT
AGAGGAAACAAGTTGTTCGAAATCGTCGGAAACGCACAACAGATTCAAAACGCCATCCAC
TTAGCTTAGAATTTATTAGATCAATTAAAAAGCACACATTAGGGATAATTTGGAGGCGGT
GCCGCCATGCAAGGTTACAACAATAACAACAGCAACTACCTTCCCAATGGCCAGAGAGAC
CCTAATGGTGGTCATGGAAGTAGCGAGAGAGGTGATGATCGTAACAGAAACGAACATTCT
CAATAAAATTATTATTAAGGCATGCAGCCATAATAGATGATGGGACAAGATCCATAGTAA
CTTTAATAGCATTATTAACAATAGCAGATGCTTATGTAACAATACTACTAGCAATAGCTT
TACTACCAATAATACTATCAGTAAATGGCAAATCCGCAAATAGAAGAAATTACTATTGAT
TAATCAAAGAGATGA