Identifiers and Description

Gene Model Identifier

TTHERM_00444570

Standard Name

KHD3 (KH domain-containing protein 3)

Aliases

PreTt03825 | 51.m00191 | 3704.m00047

Description

Zinc knuckle family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00444570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10900.19.997093137033517e-262zinc knuckle family protein (6
68 aa)
OxytrichaContig8621.0.g102.0000236365077126e-43KH domain
DictyBaseDDB_G02935543.001129784945559e-41sf1 on chromosome: 6 position
3035802 to 3037515
SGDYLR116W7.002785992501305e-33MSL5 Component of the commitme
nt complex, which defines the
first step in the splicing pat
hway; essential protein that i
nteracts with Mud2p and Prp40p
, forming a bridge between the
intron ends; also involved in
nuclear retention of pre-mRNA
WormBaseWBGene000138083.998693556225637e-29locus:sfa-1 status:Confirmed
UniProt:G5EF97 protein_id
:CAB55136.2
Stentor CoeruleusSteCoe_39031.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444570(coding)
ATGTCTAATCCAATTCCAATAGCACTAGGCGTCTTTGAAGGATAGGAAAATCTAGATTAA
TAAGAGTAAAATAAAGATAAAAAAGATAGTCAAAGCGAAAATAATTCTTAAAAAATTAAA
GATTCAGAGGAAGTCATTATCAGTGAAGAGATTGACAATGGTGGTTATTTTGATAGAACA
AATTACGATGTTTATAATGTTAAAAGGGATGGCTACTTCTTTGCAGATGAAGTTAAAGTT
GATGGTGAAACTATTTTCACAATTCCAATAGAGAAGCAATTAGAAGATAATGAAGACTTG
CCAAAAAGAAAATCAAGATGGGGTGATAGACCTTAAAGGAGAAGAAAAGTTTAAGTAAAC
CATATATTTAATCCTTTGCAAGGACTAACTACTGGAAATGGTCTTTTGTCTATTACAGCA
GATGGTTATAAGTATGGCTAATAATATCCTGATAAAAAAGAAGAAGAAGAGGAGAAATTT
TCAAGATGGGGACCTGAATACGAAAAGACTTTCCATCCTCCTCCTTTGAACTACATTCCT
CAAAATATTAACGATGATGATTTAGAATACATAATCAGACTCTACAGGTTAGACGAAATA
TAAAATAAAATGATTAATAAAATTCAAACACTCGAAGATGATTCTGATTGTAGGTCTCCA
TCTCCTGACCCAATTTACAATGAATAAGGTAAAAGAATCAACACTAGAGATTACAGAGAA
TAAGAGTCTTTGTAGAAAGAAAAATATAATTTAATAGAAGAAGCAATGAGAATTAATCCT
GCTTTTATTCCTCCTCACGATTTCAAGGTTTAGAAAAAGCAAAAGAAAATTTATCTACCA
GAACAAAATGCAGAATTATTAAAACAAAAAGTAATTGGACCTAAGGGTTAAACTCACAAA
AGACTTGAGTAGGAAAGTGGCTGTAAAATTAGTATTAAGGGTAAAGGCTCAGGAAACGGA
ATGAAGAGAGTAGAAAATGATTTCAATGATAAGCTTCATATTCTTTTGTAAGGTGATACT
GATGAATAATTAGAAAAGGGTGCTACACTCGTTGATGAAATTCTTAGAGGAGAAGATAAA
TCTAATGAAAATACTTTTAAGGGAGGAGATCTTGTTATCATTCATGATGTCCTCAATAGA
GATTTTTGTTCAAAATGCCATTAAACTGGACATAGAGATTTTGAATGTTAATCAAAGACC
ACTTTTAATAAGGTTGATGTCAAGTGTATTTATTGTGGAGATAAAGGCCATATTTCAGCT
GATTGTAAATTTAAGAGAGAGAGATAGCAGTAAAATAGAGAGAGAGGAAATGATGTAGAT
ATCAATACTTAATTCGAGTAATTTATAAATTAAGTTGAAGGAGATGATAGATTACTTAGT
AGCTTTGGTGGCAGAGCGAACTAAAATAAGTCAATTACAAATACTAGCTTTATTACTGAT
GCTATAGAAATAGATCCTAATCTTCTTATGATCAAAGCAGATGATAACCTTTACAAAAAT
ACAAAAGAACCAACATTTTCGAATGGACCTTCAGCTCCTTCTTATTCTAACGACTTCCAA
TAAGGAGGTTACAACAACAATTTCAATAAAAATAGAGACTATAGAAGGGAAACAAATGAT
TAATTTAATAAAAATAATGATAGATTTAATAGTTAGAGTGGCAGTAATAGATAATAAGAC
TCTTCTAGAGCACCTATACCTCCTCCTATCCTACCTCCAGGAAGTGATCATTTAGCCCCA
CCCTCATTTATGAATTAAAATACAATGGGTCATTTTGGTGGTTTACCCATGCCTGGTATA
GCTAATCCTTCAGCTATGCCACCACCTGGTATGCCAGGCAGTTTATATCCTCCTCCAATG
CCTCCAGGTGGTTATCCTATGTTTAATCCATATGCCCCACCAGGTTTTGGAGGTCTTCCT
CCTCCTATGTTCCCCCCACACCCTCACTTAAATGTTCCATACGGATATAATCCCTTATAT
CCATAAGGATATAATTAATAAAATTAACCACACAAATGA


>TTHERM_00444570(protein)
MSNPIPIALGVFEGQENLDQQEQNKDKKDSQSENNSQKIKDSEEVIISEEIDNGGYFDRT
NYDVYNVKRDGYFFADEVKVDGETIFTIPIEKQLEDNEDLPKRKSRWGDRPQRRRKVQVN
HIFNPLQGLTTGNGLLSITADGYKYGQQYPDKKEEEEEKFSRWGPEYEKTFHPPPLNYIP
QNINDDDLEYIIRLYRLDEIQNKMINKIQTLEDDSDCRSPSPDPIYNEQGKRINTRDYRE
QESLQKEKYNLIEEAMRINPAFIPPHDFKVQKKQKKIYLPEQNAELLKQKVIGPKGQTHK
RLEQESGCKISIKGKGSGNGMKRVENDFNDKLHILLQGDTDEQLEKGATLVDEILRGEDK
SNENTFKGGDLVIIHDVLNRDFCSKCHQTGHRDFECQSKTTFNKVDVKCIYCGDKGHISA
DCKFKRERQQQNRERGNDVDINTQFEQFINQVEGDDRLLSSFGGRANQNKSITNTSFITD
AIEIDPNLLMIKADDNLYKNTKEPTFSNGPSAPSYSNDFQQGGYNNNFNKNRDYRRETND
QFNKNNDRFNSQSGSNRQQDSSRAPIPPPILPPGSDHLAPPSFMNQNTMGHFGGLPMPGI
ANPSAMPPPGMPGSLYPPPMPPGGYPMFNPYAPPGFGGLPPPMFPPHPHLNVPYGYNPLY
PQGYNQQNQPHK


>TTHERM_00444570(gene)
ATGTCTAATCCAATTCCAATAGCACTAGGCGTCTTTGAAGGATAGGAAAATCTAGATTAA
TAAGAGTAAAATAAAGATAAAAAAGATAGTCAAAGCGAAAATAATTCTTAAAAAATTAAA
GATTCAGAGGAAGTCATTATCAGTGAAGAGATTGACAGTACGAGATAGAATTTCTTAATT
TAAAATAGATTGATCGCAATCACCTTCATCTTTAAATCCAAAATAAAGTTATAAAAGCAT
GCAGGCTAATTATAAAAAATAATTAGGCAGCAAGATTGAAGAGATTTATTTTAAGTTTTG
TATTTTAAAATAAAATAAGATTACTGGTTTAAAAAACTTAAAGATTCATTCAATAATTTG
AGGATTAAATATTTATTTGCAGATTTCAATCTAGCTTAAATTGCATTAAAAAAATAGTTT
ATCACAAAGAAAATTCTCTAATTTGAACTATTGATAGATGAATGATTGAAAGATTATAAA
CATATTTATATAGTTAAAACAATTAATATTAAATTTTTTATTTTTAAATTTATATATAGA
TGGTGGTTATTTTGATAGAACAAATTACGATGTTTATAATGTTAAAAGGGATGGCTACTT
CTTTGCAGATGAAGTTAAAGTTGATGGTGAAACTATTTTCACAATTCCAATAGAGAAGCA
ATTAGAAGATAATGAAGACTTGCCAAAAAGAAAATCAAGATGGGGTGATAGACCTTAAAG
GAGAAGAAAAGTTTAAGTAAACCATATATTTAATCCTTTGCAAGGACTAACTACTGGAAA
TGGTCTTTTGTCTATTACAGCAGATGGTTATAAGTATGGCTAATAATATCCTGATAAAAA
AGAAGAAGAAGAGGAGAAATTTTCAAGGTATTTTTTTTAAGACCATTCTTCTTAGTATTT
TAATTTTAATATTGTAAAAAGATGGGGACCTGAATACGAAAAGACTTTCCATCCTCCTCC
TTTGAACTACATTCCTCAAAATATTAACGATGATGATTTAGAATACATAATCAGACTCTA
CAGGTTAGACGAAATATAAAATAAAATGATTAATAAAATTCAAACACTCGAAGATGATTC
TGATTGTAGGTCTCCATCTCCTGACCCAATTTACAATGAATAAGGTAAAAGAATCAACAC
TAGAGATTACAGAGAATAAGAGTCTTTGTAGAAAGAAAAATATAATTTAATAGAAGAAGC
AATGAGAATTAATCCTGCTTTTATTCCTCCTCACGATTTCAAGGTACTAAACTTTTCAAT
AAAATAAAAAAGATATTTAAGTTTATTTATTTAAAAATTTTAAGAAAAAAGCTTACAATA
AATGCACTAAAATTAGAAAATATTATTTAAATTTTAAAACAAATTATTAAAATAATTATA
AATTCAAAAATTGTTTTACAATGTTAGATTAAAATTGAAGAAAAAGTGAAAGCAATTAAA
AAGATTAAAAATCTATTTATAATTTAAATAGCGAGATATTTATTACATAGACAAAACTCA
AAATATTATTTTAATAATTTAATAATATATTTCTAACAAAATTTAATAATACAATGAGCT
TCAATAATTTAGAATCTATCTATTATTTAATAAAGAAAGAATTGTCAAAAACAAACATAT
TTATTACTAAAAATTTACATTTTAACTTTCTTAATTAATATAGGTTTAGAAAAAGCAAAA
GAAAATTTATCTACCAGAACAAAATGCAGAATTATTAAAACAAAAAGTAATTGGACCTAA
GGGTTAAACTCACAAAAGACTTGAGTAGGAAAGTGGCTGTAAAATTAGTATTAAGGGTAA
AGGCTCAGGAAACGGAATGAAGAGAGTAGAAAATGATTTCAATGATAAGCTTCATATTCT
TTTGTAAGGTGATACTGATGAATAATTAGAAAAGGGTGCTACACTCGTTGATGAAATTCT
TAGAGGAGAAGATAAATCTAATGAAAATACTTTTAAGGGAGGAGATCTTGTTATCATTCA
TGATGTCCTCAATAGAGATTTTTGTTCAAAATGCCATTAAACTGGACATAGAGATTTTGA
ATGTTAATCAAAGTAAAAATGTTGCAATTTATAAACATTAATTTAATGATTTCTTTTTTT
AAAAAAAATAGGACCACTTTTAATAAGGTTGATGTCAAGTGTATTTATTGTGGAGATAAA
GGCCATATTTCAGCTGATTGTAAATTTAAGAGAGGTAAATAATAAAAATAAAATAATATG
ATAAATATGAAAAAATCTTTTATCATAAATATAGAGAGATAGCAGTAAAATAGAGAGAGA
GGAAATGATGTAGATATCAATACTTAATTCGAGTAATTTATAAATTAAGTTGAAGGAGAT
GATAGATTACTTAGTAGCTTTGGTGGCAGAGCGAACTAAAATAAGTCAATTACAAATACT
AGCTTTATTACTGATGCTATAGAAATAGATCCTAATCTTCTTATGATCAAAGCAGATGAT
AACCTTTACAAAAATACAAAAGAACCAACATTTTCGAATGGACCTTCAGCTCCTTCTTAT
TCTAACGACTTCCAATAAGGAGGTTACAACAACAATTTCAATAAAAATAGAGACTATAGA
AGGGAAACAAATGATTAATTTAATAAAAATAATGATAGATTTAATAGTTAGAGTGGCAGT
AATAGATAATAAGACTCTTCTAGAGCACCTATACCTCCTCCTATCCTACCTCCAGGAAGT
GATCATTTAGGTAGCTAAAATTTCATTTCATGTATTATTAAAAATTAACTATTTTCTAAA
TAATTAGCCCCACCCTCATTTATGAATTAAAATACAATGGGTCATTTTGGTGGTTTACCC
ATGCCTGGTATAGCTAATCCTTCAGCTATGCCACCACCTGGTATGCCAGGCAGTTTATAT
CCTCCTCCAATGCCTCCAGGTGGTTATCCTATGTTTAATCCATATGCCCCACCAGGTTTT
GGAGGTCTTCCTCCTCCTATGTTCCCCCCACACCCTCACTTAAATGTTCCATACGGATAT
AATCCCTTATATCCATAAGGATATAATTAATAAAATTAACCACACAAATGA