Identifiers and Description

Gene Model Identifier

TTHERM_00051720

Standard Name

KHD1 (KH domain-containing protein 1)

Aliases

PreTt11353 | 3.m01791 | 3824.m03106

Description

KHD1 KH domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00051720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01596.19.997093137033517e-262KH domain-containing protein (
694 aa)
OxytrichaContig17537.0.g937.002264059090237e-38KH domain
WormBaseWBGene000227380.00000000000040012475857291343status:Confirmed UniProt:Q7Z
145 protein_id:CCD61630.1
SGDYLR116W0.000000000006001570085597868MSL5 Component of the commitme
nt complex, which defines the
first step in the splicing pat
hway; essential protein that i
nteracts with Mud2p and Prp40p
, forming a bridge between the
intron ends; also involved in
nuclear retention of pre-mRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00051720(coding)
ATGAGACATTCGTCATCTAAATCTAGATCAAGATCAAAGGGTAACAAACGCGGTGGATAA
AAAAGATCTTCACAAGATAGAGGATCTTATAAAAGAAGCTTCAGTAGATCTGATAGCAGA
GGAAAAGATTCAAAAAGAGGGGGAGGAGATTTCAATTCTAGAAGACGCAACAAATTTTCA
GATCCTTCATAGAATGGTGGAAGTAGCTAAAGAGGTGGCTTTAGCAGTGGTTTCAATGAT
TCAAATAGTAATTAGAGAAACGATGATAGAGGTTATCAGAGTGGAAATGGAGGATTTGGA
TCTAAAGGAGGATAATAGTATGGATCTAGAAACGATAATGGATACAAAGGAGATTAGAAT
GGAAATGGAGGCTTTTCTTACAACAATGTCAGGAATTCTTAAGGACCTAATATGAATGAA
GACATAGACAGAATTTTACAGAATTCAAAACCTGAATCTTCATACAACCGTAACTAATAT
GATAGATCTTCAAATGGAGTAGGCTTTAACAATAATTTTTCAGGAAATTCAGGATAAGGA
AGTAGTTACGATAACTACCAGATATCTACTTCTTCATTAAGATAATCTTCTTCAAAAACT
TTCCGCAAAGTCCCTATTCCTTAAGATGGGAAATTTAATTATATTGGACTAATTATTGGC
CCAAAGGGTTCTAAACAAAAGTAATTAGAAGAAATGACTCATTGTAAAATTTTAATCAGG
GGAAAGGGCTCTCAAAAATAAGGTGCACCTTAATAGCCTGATGATAATGAAGACTTACAT
GTTTTAATTGAGGCAGATTCTGAAATGAATGCAAACAAAGCCATGAAAGAAATCGAAAAT
ATCATTTTTATGGATGATGACTAAAAAGTTAAGCTCCGTGATTAGTAACTTAAGTCTAAT
TACAATGGTGGCTAGTAACATAGACCAGATGGTTAATATAACAATAATAATGACAGATAG
ACTTTCATTTAAATTCCAAAAGATGTTGTAGGACTTGTGATTGGAAAGAAAGGTGAAACA
ATCAAATAAATCAAAGAAAAGTCAGGTGCTGATAAAGTTTACATGCAACCTGAAAATTAA
CGCAATTAATAAGATGATTCCTATTAAAATCTTATTGTAGAAGGCTCTGCAAGCTAAGTT
GAAAGAGTTAGAGAGCTAGTCAATGACATTAAAAACTAATAGCAACAAAAGAAATAAGGG
TACAACGATAATTTTAATAACAACAATTTCAATAATAGAGGTGGTAATTAAAAGCAAGAA
GCTAGAATAGAAATGGAAATACCAGCAAATTTGGCTGGTTTAGTCATTGGATCTAAAGGC
TCTACCTTGCAATAAGTGGGTAGTGAAACAAGGACACGTTGTTAAATTAATTAAAACAAT
AATGACAACAGAAAAATATTAATAATTGTTGGTAATACAGAAGAGGATTGCCAAAGAGCT
AAAGAAATATTCTAAGAAAAAATGAACAGCAGAATGGCAGGAAACTAAAATGACAGAGAC
AATAACTAAAGAGGAGGTGGTTTCAATAATAGAGGGAATAATAATAGTAGTAGAGGAGGA
GGCAGAACCTTTAATAACCGTCGTCCTCGTAAGAATGCTGATGATGATGAAATTGTAGAA
GCATATTAGTTTGAATCATATCCTACTTACAATCTTGAAGAATAAATGATGCATAGCTAG
TAAATGTTGCTTAACATGCAAAATTTCTACAATCAATAGGGTTAATATCCTCCTTAGTAA
TAAGTTCCACCTGCATACGGCAATCAGCAATAATAGTAACCCAGTGATTCATATGCTGTA
GATTCCAAACCTGGTTAGTCAACTGATAATTTAACTAACACTAATATTTCTACTTCAGAA
AATAACACCGTAAATTCTATTTCACCTCAACCCCAATAATAAGCTGCAACTACAGAATTT
TAGCAGTATCCATAACCATATGGTTAAGCACCAGGCTATGATCCAAACTAAGTGTAAATG
TAAATCTCATAATATCTTTAATATTAGCAAATGTACTTGCAAACACAAAGCTACACAGGA
CCTGTTATTGAAGAAGTACTAGCTGACGGAACCATAGTTTCTCTAAGTTAAAATGCAGAT
GACAAAAAGAAAGGTAAGAGAGGAGGTAGAAGATGA


>TTHERM_00051720(protein)
MRHSSSKSRSRSKGNKRGGQKRSSQDRGSYKRSFSRSDSRGKDSKRGGGDFNSRRRNKFS
DPSQNGGSSQRGGFSSGFNDSNSNQRNDDRGYQSGNGGFGSKGGQQYGSRNDNGYKGDQN
GNGGFSYNNVRNSQGPNMNEDIDRILQNSKPESSYNRNQYDRSSNGVGFNNNFSGNSGQG
SSYDNYQISTSSLRQSSSKTFRKVPIPQDGKFNYIGLIIGPKGSKQKQLEEMTHCKILIR
GKGSQKQGAPQQPDDNEDLHVLIEADSEMNANKAMKEIENIIFMDDDQKVKLRDQQLKSN
YNGGQQHRPDGQYNNNNDRQTFIQIPKDVVGLVIGKKGETIKQIKEKSGADKVYMQPENQ
RNQQDDSYQNLIVEGSASQVERVRELVNDIKNQQQQKKQGYNDNFNNNNFNNRGGNQKQE
ARIEMEIPANLAGLVIGSKGSTLQQVGSETRTRCQINQNNNDNRKILIIVGNTEEDCQRA
KEIFQEKMNSRMAGNQNDRDNNQRGGGFNNRGNNNSSRGGGRTFNNRRPRKNADDDEIVE
AYQFESYPTYNLEEQMMHSQQMLLNMQNFYNQQGQYPPQQQVPPAYGNQQQQQPSDSYAV
DSKPGQSTDNLTNTNISTSENNTVNSISPQPQQQAATTEFQQYPQPYGQAPGYDPNQVQM
QISQYLQYQQMYLQTQSYTGPVIEEVLADGTIVSLSQNADDKKKGKRGGRR


>TTHERM_00051720(gene)
ATGAGACATTCGTCATCTAAATCTAGATCAAGATCAAAGGGTAACAAACGCGGTGGATAA
AAAAGATCTTCACAAGATAGAGGATCTTATAAAAGAAGCTTCAGTAGATCTGATAGCAGA
GGAAAAGATTCAAAAAGAGGGGGAGGAGATTTCAATTCTAGAAGACGCAACAAATTTTCA
GATCCTTCATAGAATGGTGGAAGTAGCTAAAGAGGTGGCTTTAGCAGTGGTTTCAATGAT
TCAAATAGTAATTAGAGAAACGATGATAGAGGTTATCAGAGTGGAAATGGAGGATTTGGA
TCTAAAGGAGGATAATAGTATGGATCTAGAAACGATAATGGATACAAAGGAGATTAGAAT
GGAAATGGAGGCTTTTCTTACAACAATGTCAGGAATTCTTAAGGACCTAATATGAATGAA
GACATAGACAGAATTTTACAGAATTCAAAACCTGAATCTTCATACAACCGTAACTAATAT
GATAGATCTTCAAATGGAGTAGGCTTTAACAATAATTTTTCAGGAAATTCAGGATAAGGA
AGTAGTTACGATAACTACCAGATATCTACTTCTTCATTAAGATAATCTTCTTCAAAAACT
TTCCGCAAAGTCCCTATTCCTTAAGATGGGAAATTTAATTATATTGGACTAATTATTGGC
CCAAAGGGTTCTAAACAAAAGTAATTAGAAGAAATGACTCATTGTAAAATTTTAATCAGG
TAAATTTCCAAAAAATAAATACTGCTTTTAAATTATGTCTGTATGAATAATTATAAAAGC
AAATTTCGCCCATTATTTCATAAATATTTATTTACTTTTTTATGATTTTTTCTCATTATT
TTGCTTTTCGAATTTACATTGAGCTGGGTATATCTACTTAACCTGACTGATGTCTATCAA
TTAATTAATTATTTAATTAATTAGTTGCCAAATCAATTATAATTATTTAATTTTCCCTAA
ATCACTTTTTTTTATAATAATAATTATAATAATATTCAAATTTTAATTAAAGTAACTCAA
TTTTTTTTGCTTTCAAAAAATTAAATAAATAAATGATTAATTAACAAATAATTATTATAT
ATATCTTAATCATTTAAATACTTAATAATAGGGGAAAGGGCTCTCAAAAATAAGGTGCAC
CTTAATAGCCTGATGATAATGAAGACTTACATGTTTTAATTGAGGCAGATTCTGAAATGA
ATGCAAACAAAGCCATGAAAGAAATCGAAAATATCATTTTTATGGATGATGACTAAAAAG
TTAAGCTCCGTGATTAGTAACTTAAGTCTAATTACAATGGTGGCTAGTAACATAGACCAG
ATGGTTAATATAACAATAATAATGACAGATAGACTTTCATTTAAATTCCAAAAGATGTTG
TAGGACTTGTGATTGGTAAAAACATTTTCTTTTATTTTTTCATTTTTTACAATGTTTATT
AATTTATTAATAGGAAAGAAAGGTGAAACAATCAAATAAATCAAAGAAAAGTCAGGTGCT
GATAAAGTTTACATGCAACCTGAAAATTAACGCAATTAATAAGATGATTCCTATTAAAAT
CTTATTGTAGAAGGCTCTGCAAGCTAAGTTGAAAGAGTTAGAGAGCTAGTCAATGACATT
AAAAACTAATAGCAACAAAAGAAATAAGGGTACAACGATAATTTTAATAACAACAATTTC
AATAATAGAGGTGGTAATTAAAAGCAAGAAGCTAGAATAGAAATGGAAATACCAGCAAAT
TTGGCTGGTTTAGTCATTGGATCTAAAGGCTCTACCTTGCAATAAGTGGGTAGTGAAACA
AGGACACGTTGTTAAATTAATTAAAACAATAATGACAACAGAAAAATATTAATAATTGTT
GGTAATACAGAAGAGGATTGCCAAAGAGCTAAAGAAATATTCTAAGAAAAAATGAACAGC
AGAATGGCAGGAAACTAAAATGACAGAGACAATAACTAAAGAGGAGGTGGTTTCAATAAT
AGAGGGAATAATAATAGTAGTAGAGGAGGAGGCAGAACCTTTAATAACCGTCGTCCTCGT
AAGAATGCTGATGATGATGAAATTGTAGAAGCATATTAGTTTGAATCATATCCTACTTAC
AATCTTGAAGAATAAATGATGCATAGCTAGTAAATGTTGCTTAACATGCAAAATTTCTAC
AATCAATAGGGTTAATATCCTCCTTAGTAATAAGTTCCACCTGCATACGGCAATCAGCAA
TAATAGTAACCCAGTGATTCATATGCTGTAGATTCCAAACCTGGTTAGTCAACTGATAAT
TTAACTAACACTAATATTTCTACTTCAGAAAATAACACCGTAAATTCTATTTCACCTCAA
CCCCAATAATAAGCTGCAACTACAGAATTTTAGCAGTATCCATAACCATATGGTTAAGCA
CCAGGCTATGATCCAAACTAAGTGTAAATGTAAATCTCATAATATCTTTAATATTAGCAA
ATGTACTTGCAAACACAAAGCTACACAGGACCTGTTATTGAAGAAGTACTAGCTGACGGA
ACCATAGTTTCTCTAAGTTAAAGTAATTAATTATTCAATTCAGGTTATTATCAAAATAAA
AAATAAAAATTTGATAAAAAGCTTAATTTTTGCTAACCTAATTATAAAGTAAATAAAAAG
AAGCAAAGTTAGTAAAATATAAACTGGATTTATTAATTTTGTTTACAGAAATTATTAACA
GCTAAATAAATTTATGAATATTTAAAATTAAATTAAATTAAAAATTTTATTTTAATTAAA
ATAGATGCAGATGACAAAAAGAAAGGTAAGAGAGGAGGTAGAAGATGA