Identifiers and Description

Gene Model Identifier

TTHERM_01445920

Standard Name

KFK1 (Fusion of ser/thr kinase and Ca2+/calmodulin protein kinase.)

Aliases

PreTt29103 | 394.m00007

Description

Fusion of ser/thr kinase and Ca2+/calmodulin protein kinase. Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01445920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40732.11.9995118794191673e-87hypothetical protein (643 aa)
DictyBaseDDB_G02793432.0002795641672355e-21aurK on chromosome: 3 position
1959552 to 1961164
SGDYFR014C9.000561397357242e-21CMK1 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk2p and mammalian
Cam Kinase II
OxytrichaContig10046.0.g493.0002687256732656e-20Protein kinase domain
WormBaseWBGene000005539.004296568159186e-20locus:cmk-1 Calcium/calmodul
in-dependent protein kinase ty
pe 1 status:Confirmed UniP
rot:Q9TXJ0 protein_id:CCD718
65.1
Stentor CoeruleusSteCoe_276940.00000000027894680928689246

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01445920(coding)
ATGTCTAAGAAAGTTCAAAACGAGTTAGTCGAAATTATCTCAAGCAAAGTATCCAAAGAT
TGCTAAATTCAAAAAGTATCAATAAAGGAATTGATCAAGTTAATGTTCAGCTAGAAAAAA
CACTTCAAAAATTTTGAGTACTTAAGTAGTGGCGCTTATGCTCTTGTCTTAAAAGCTTAG
AATTCTTAACAAAATCGCCAAGTAGCTCTCAAATTCTTAGAAAGTACCAACAAAGAGGAC
AAGGATGGTATCGAATCTATGAAAAAAGAGTATGAAATGCTTCAAAAGTTTAGCCAATCA
GAATGTTTAGTAAATGTCTATGATTGTTTCTATTTAATGGAAGAAAAAGATGATGGAAAC
GACATTATCGTTTAAACTGAAAACAAGTCCTACTTTGTAATGGAAATGGAGCTTTGCGAG
AATAATCTCAAATAACTCTTTGATTTCCTCAGAAAATTTTAAGTTCCACATCAGAAAAAA
ATAAAGGAAATAATAGCCATTCAAATGATAGAAGGGTTGAATAACCTTCATGTCAAAAAT
ATTATGCACAGGGATATTAAACCTTAAAATTTCTTTGTTTGCGCCTCTAAGGAATATGGT
TTCTCAGTCAAACTTTGTGATATTGGCTTTGCATCAGCTGTGTCTAAATCAAAAAGCTTC
ATGTCAAAGAAAGGAACTGATGCATATTTTGCTCCAGAAGTGGAAGCAGGACAATCTAGA
ATTCAGTCAGATCTCTTTTCACTAGGACTCGTTTTATTAGAGCTTGACAATCTCAAAACT
CTAAATGAGAATTGGATAGATACTAAAACAAAAAATTATCTATTCAATGGAGAAGAAATA
CCTAATGAAAAATATTAGATAGATAAGAATTCTAATATTTACAAAATAGCTAAAATATGC
TTAAAACCTTGGTATTTAGACAGGACTACAACAGGAGAATTACTATCTTAGCTAATCTAA
ATGCATGGTTAACCATTGAAATTTGTATTGACTTCTATGATACTAGAGGAATAAATACCT
AGATAGGCACAGTAAATATTTGAAAAAATTAATCAACTACAAAAACAAACGCAAAATTAA
TTCGACGAGTATGCTAAGTTTATTCTAGAGAACACCAATGACAAAATTAAACAAAAAGAT
TTTCAAGCACAATTTACAAAAGTGGAAGTATTATCTAATCTGCTGAAAAGTCTCTATGAA
AATAAAAAATATACGAATAATTTTCAAATTCTAAGCTTTGGAAGCTTTGGAATGGTATTA
GCTACTAAAAAAGCTAAACTTGATAAAAAAGAAATAGTGTTAAAAATACAAAAAATAGAA
GATGAATAACATATCTAAAATGAAATTAGTATTATGTAGAAATTAAAAGAGCCACTAGTG
GTATAGCTTTATGATAGCTATATAATAGAGAATAAAATAGGACCTGATAGATACTCAGTC
TTTGAATTAGAAAAATGCTCATGTTCGTTAGATGAATATCTTGATAGATAAAACAAAGAT
GGATAATTTAACGACGATGATAAATATTAAATAGCGATCTAAATTATAGATTCTGTTAAT
TATATTCACTCATTTAATATCATTCATAGAGATATTAAACCAGAAAATTTTTTGGTTTAT
TTAGATGGAAAATAACCAGAAATAAAATTATGTAATTTCGGCTTATCTGCTTAGATTCCA
GATAATAAAGATTCAATTCAAGCTATAGAAAGCATAGGTAATTTAGGATATTCAGCACCT
GAAATACTAAATAAATAGGATAATGAACTTAAGATTTATTCAAAGAAATCTGATTCATAT
TCAGTAGGATTATTACTAGCTTTTTTAGATAATTATTAAGATCTGAAGAAAAATGCACCT
TTTACTTTCTTATTAATGACAAAAAAGCAGTTCGATAAGCCTTTCGAAAAATCTAAGATT
AAAATTAACAAAAATTCAGAAATTTATAAATTTATTAACCTTCTTGTTGTTTCTGATAGT
GGTTAAAGAGCATCTCTGTATGATATTGTTGAATAAAGCGATACAAAATTCTTAACTAAT
TCAAAAGAAATGAAAGAAATTAGATCTATAAAGGATTTGAGCAAAGCTTAAAATTACAAT
ATTGTCACAATAGATTTAAACGATAATAGTATTGGTGCATAGGGTGCAAAAGATTTAGGC
ACAGGAATAGCGTAGTGCAAGAATATCACAAGTTTGACACTTTATTTAA


>TTHERM_01445920(protein)
MSKKVQNELVEIISSKVSKDCQIQKVSIKELIKLMFSQKKHFKNFEYLSSGAYALVLKAQ
NSQQNRQVALKFLESTNKEDKDGIESMKKEYEMLQKFSQSECLVNVYDCFYLMEEKDDGN
DIIVQTENKSYFVMEMELCENNLKQLFDFLRKFQVPHQKKIKEIIAIQMIEGLNNLHVKN
IMHRDIKPQNFFVCASKEYGFSVKLCDIGFASAVSKSKSFMSKKGTDAYFAPEVEAGQSR
IQSDLFSLGLVLLELDNLKTLNENWIDTKTKNYLFNGEEIPNEKYQIDKNSNIYKIAKIC
LKPWYLDRTTTGELLSQLIQMHGQPLKFVLTSMILEEQIPRQAQQIFEKINQLQKQTQNQ
FDEYAKFILENTNDKIKQKDFQAQFTKVEVLSNLLKSLYENKKYTNNFQILSFGSFGMVL
ATKKAKLDKKEIVLKIQKIEDEQHIQNEISIMQKLKEPLVVQLYDSYIIENKIGPDRYSV
FELEKCSCSLDEYLDRQNKDGQFNDDDKYQIAIQIIDSVNYIHSFNIIHRDIKPENFLVY
LDGKQPEIKLCNFGLSAQIPDNKDSIQAIESIGNLGYSAPEILNKQDNELKIYSKKSDSY
SVGLLLAFLDNYQDLKKNAPFTFLLMTKKQFDKPFEKSKIKINKNSEIYKFINLLVVSDS
GQRASLYDIVEQSDTKFLTNSKEMKEIRSIKDLSKAQNYNIVTIDLNDNSIGAQGAKDLG
TGIAQCKNITSLTLYL


>TTHERM_01445920(gene)
ATGTCTAAGAAAGTTCAAAACGAGTTAGTCGAAATTATCTCAAGCAAAGTATCCAAAGAT
TGCTAAATTCAAAAAGTATCAATAAAGGAATTGATCAAGTTAATGTTCAGCTAGAAAAAA
CACTTCAAAAATTTTGAGTACTTAAGTAGTGGCGCTTATGCTCTTGTCTTAAAAGCTTAG
AATTCTTAACAAAATCGCCAAGTAGCTCTCAAATTCTTAGAAAGTACCAACAAAGAGGAC
AAGGATGGTATCGAATCTATGAAAAAAGAGTATGAAATGCTTCAAAAGTTTAGCCAATCA
GAATGTTTAGTAAATGTCTATGATTGTTTCTATTTAATGGAAGAAAAAGATGATGGAAAC
GACATTATCGTTTAAACTGAAAACAAGTCCTACTTTGTAATGGAAATGGAGCTTTGCGAG
AGTAAAAAAAACCATAAATTTTTCATCCATTTTTTTTTTTTTTTCATTTTTTAAGAAACG
TGTAAAAATACATAAAATAAGATATATTTATACTTTTTATTGACCTGACCTAGCTTACGC
ATCACCATTTTTAAAATAGGTAATTTTAATTTTTTTTCTAAGTCTTTTTTTGATTTTGAT
AGCTAATTAAAAAAAATTAGATTTGCGCTAAGCAGATTTAATTAATTTAGAAAATATAAT
AGAAATTATTTAATTTAATATAAAAACGTTAATTTTAATTAATTTTTTAGGATTCCCCAC
CATTAAGACTTTTTCATTTATTTTTAATCAAATTTTGTAAGATTTCTTAATTAAACTTTC
TAGAAGATTAATTCATCAAAATTTTATAATCTATTTACCCAATATAACAATTTAATTTTT
TAATAAGCAATTTTCATAAATATTATTAATTTATTTATTTATAATATATAAGAAAATAAA
TTAAAAATGTTATTTGATTTAAAAATTGAATTAATTATTACCTAAAAAATTAATTAGTTT
TAACTATCCTCCAAAATTTTTTTTAACTTAAATTCAAAAATAAATATTTAAAAGATATAA
AGATATTAATAACTGAAAAAATATAAATTATTTCAATAAAAATTATAATGAGTAAACTAT
GTAAATTTCTCATGAGAGACTAAAATTAAACAACTTTAATAGTATAAGTAATCCACTTGT
GTTGAAATAAATAATTTCTAAAAATATTAAATATTTAGTTAAATAAATAAGATAAATTCT
AAAATAAATTACTATAAAATAATCCTTTATTTTTTATAATATAGGTTTAAAAAACAATAT
TATTAAATAAATTATTTAACTCAAAGCTTTTATTAATAAATAAATGAATAAATCCCATTT
CAAAAATTTTATTTTCCTCTCTAAGTTTTTAAAAAATAAAAAATTTTTGCAAATAATTTA
AAAATTTAAAAACAAACATTTTTTAAATAAAAATTTAAACATAAAACTAATTTAATTTTA
TAATTAACTAGATAATCTCAAATAACTCTTTGATTTCCTCAGAAAATTTTAAGTTCCACA
TCAGAAAAAAATAAAGGAAATAATAGCCATTCAAATGATAGAAGGGTTGAATAACCTTCA
TGTCAAAAATATTATGCACAGGGATATTAAACCTTAAAATTTCTTTGTTTGCGCCTCTAA
GGAATATGGTTTCTCAGTCAAACTTTGTATATAATTATTTTTATATTATTTAATATTTAA
TAAATATTTTTTAAATTCAGGTGATATTGGCTTTGCATCAGCTGTGTCTAAATCAAAAAG
CTTCATGTCAAAGGTTAAAAAATTAATTATTATTTTAATTGGTTTCAATATTTTTTATAA
TTTTCAGAAAGGAACTGATGCATATTTTGCTCCAGAAGTGGAAGCAGGACAATCTAGAAT
TCAGGTTTTTAATAATAGTGTTATATAATTTTTTAAAGTTTATTTACATTAAATAGTCAG
ATCTCTTTTCACTAGGACTCGTTTTATTAGAGCTTGACAATCTCAAAACTCTAAATGAGA
ATTGGATAGATACTAAAACAAAAAATTATCTATTCAATGGAGAAGAAATACCTAATGAAA
AATATTAGATAGATAAGAATTCTAATATTTACAAAATAGCTAAAATATGCTTAAAACCTT
GGTATTTAGACAGGACTACAACAGGAGAATTACTATCTTAGCTAATCTAAATGCATGGTT
AACCATTGAAATTTGTATTGACTTCTATGATACTAGAGGTAATAAATATATTATTTCAAA
ATTAATTTATTCAAAATTTAATCTTATTTAATAAGCTAATTTTAAATGTTGCCTAAAAGA
AATTAAATTTTATTGAAACTCTTAAAAATATCATTAAAAACAATTTAAAACAAAATATTT
TATATTTTCTTAACAAATTGGATAAAATAAAAATAATGTTATGAGTTTAATAAAATAAGA
ATGGCTTATCTGCAACAAAATTTTTTATTTTAAAATAAAAAACACATCATTTTTAAACTA
TCAAATAAAATTTATAAAAATGAAAAAATAAACTTATTATTTCTTTTATTATTGACCTAA
ATATATTGTTATTTTCCTCAATAGTTAGTAAAAAAAGAAGTTTTATTTCATAATAAATTT
TTTTATTACATTAATCTCTCAAAATAAAAAAAATTGATTTTACTTTTGGAATATTTGAAT
TCAATAAATAATTTTATTTGTAATATAATAAAAGGAATAAATACCTAGATAGGCACAGTA
AATATTTGAAAAAATTAATCAACTACAAAAACAAACGGTAATTATTTTTAGCTTAAATTT
TTATAAAAAGTTATAAATTAAATGTAAATTAAAAAATAATTAATTTAAAGCAAAATTAAT
TCGACGAGTATGCTAAGTTTATTCTAGAGAACACCAATGACAAAATTAAACAAAAAGATT
TTCAAGCACAATTTACAAAAGTGGAAGTATTATCTAATCTGCTGAAAAGTCTCTATGAAA
ATAAAAAATATACGAATAATTTTCAAATTCTAAGCTTTGGAAGCTTTGGAATGGTATTAG
CTACTAAAAAAGCTAAACTTGATAAAAAAGAAATAGTGTTAAAAATACAAAAAATAGAAG
ATGAATAACATATCTAAAATGAAATTAGTATTATGTAGAAATTAAAAGAGCCACTAGTGG
TATAGCTTTATGATAGCTATATAATAGAGAATAAAATAGGACCTGATAGATACTCAGTCT
TTGAATTAGAAAAATGCTCATGTAATTTATTAAATTCTTAATATTTATTTTAATTTAGGT
TTCAATTAACTACTTATGAAGATATTTTTATCATATAAAACCCAATTTTTAATAAATAAA
CAAATGAATAAATATATTTTTTTATAAAAAAGAATTTAATTTGTTTTTTAAATTTAAAAA
AAATAAAAATTTAATTTATAAATTGTAAAAAGAATTATTTTTAACGAAAATAATTATTAT
ACTTTCATTATTTTGAAAGATTTTTAATATAAAAATGATATTTAAAAAATATATTTGATT
ACATTTTACTTTTTATTTTGTAAAAGGTTCGTTAGATGAATATCTTGATAGATAAAACAA
AGATGGATAATTTAACGACGATGATAAATATTAAATAGCGATCTAAATTATAGATTCTGT
TAATTATATTCACTCATTTAATATCATTCATAGAGATATTAAACCAGAAAATTTTTTGGT
TTATTTAGATGGAAAATAACCAGAAATAAAATTATGTAAACTATTTTTATGCATAAATTA
TTTTTCATTATCTTTTAATTTTAAGGTAATTTCGGCTTATCTGCTTAGATTCCAGATAAT
AAAGATTCAATTCAAGCTATAGAAGTAGATTTTTAATTTTATATATTTAAATATTAAAAA
TAACTTTATATATAGAGCATAGGTAATTTAGGATATTCAGCACCTGAAATACTAAATAAA
TAGGATAATGAACTTAAGATTTATTCAAAGAAAGTAATTTTTTTATAAAAATGTTAATTT
TAAATTAATTTCTTATTTTAGTCTGATTCATATTCAGTAGGATTATTACTAGCTTTTTTA
GATAATTATTAAGATCTGAAGAAAAATGCACCTTTTACTTTCTTATTAATGACAAAAAAG
CAGTTCGATAAGCCTTTCGAAAAATCTAAGATTAAAATTAACAAAAATTCAGAAATTTAT
AAATTTATTAACCTTCTTGTTGTTTCTGATAGTGGTTAAAGAGCATCTCTGTATGATATT
GTTGAATAAAGCGATACAAAATTCTTAACTAATTCAAAAGAAATGAAAGAAATTAGATCT
ATAAAGGATTTGAGCAAAGCTTAAAATTACAATATTGTCACAATAGATTTAAAGTAATAT
TTTCATTTTAATTTAGATTTTTAATATTTTATTAATGATCAATTTTACACTTTTTAAATC
TATTTTGTTGATAATATTTTCTCGTTAAAAATTAGTTTATTAAAGTAAGTAAATTATATT
TATATTTACTAACTTAATTTTTTAAATAATTGTAAAATTCTATTATCAAATGAGAAAAAA
TGTATTTTTGAAAATTTTTTAGCTCTTTTTATTTGTTAAATTAAAAAAAAAATCCTCTTT
TTAATTAGATATTTTCGAGTAATTATGATTTTAATAATAAAATTGATGAATTGATTAACT
AAATATAATTGCTAAATTTTAAAATATAAAACAGTAAAATAGTTTATTACACAATATTTT
TCTTATTTTAAAATATCATATTAGCTTCAAATAAATTTAAATAAAAAAAGCAATAAGGCT
ACATATTCTTCAAATTTAAATACCTGGATTAGCAATATATAAAAAATGATTATTTTTTTT
TAAATTAATAAAAAATTAAAGTTAAAAATAAAAATTAATGATAAATGAATTTAAAAATAT
AATTCATTCTGATAATTGAGTATAATTCATAAAATTTAAGATTCATTTTTTTTTTTAACC
AGTGAATTGTTCATGAAAATTAAATATCTATAAAATTACTTATTTTCTATTAAGATTTAT
TTTTTAATTCATTATAGTTTATTTATATTTATATAATAGAATTAAGTATTTTTTAATTTT
TACATTAATGATACTTAAATAGTAAATGAATTAAGAATTATTAATTTAATGGTTTTAATA
ATTTTTAATCCTTAAAAAACAAATTAAAATACTAACAAAAGCAACAATATTTTTTTTTAT
ATACTCCTCAAAAGAAAATAATCAATTTGTTAACTTATTTACTTACTTACATACTGAGTT
ACTTACTCCTTCAAAAACAAACGAACATACTAACAAAAGCAACAATCTTTTTTTACAATC
CTTTCTCCTCCAAATTTATTTTCTTAATTCATTATTTATTCTTATATTTAAAGCGATAAT
AGTATTGGTGCATAGGGTGCAAAAGATTTAGGCACAGGAATAGCGTAGTGCAAGAATATC
ACAAGTTTGACACTTTATTTAA