Identifiers and Description

Gene Model Identifier

TTHERM_00784600

Standard Name

KET2 (Fusion of a kinesin and an ER-golgi vesicle tethering protein )

Aliases

PreTt25564 | 131.m00137 | 3813.m01641

Description

Fusion of a kinesin and an ER-golgi vesicle tethering protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00784600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11436.19.997093137033517e-262kinesin motor domain-containin
g protein (1251 aa)
SGDYGL216W3.999970367130025e-21KIP3 Kinesin-related motor pro
tein involved in mitotic spind
le positioning
WormBaseWBGene000038849.997019043202629e-21locus:osm-3 Osmotic avoidanc
e abnormal protein 3 status:
Confirmed UniProt:P46873 p
rotein_id:CCD70203.1
OxytrichaContig781.1.g643.9992896861436003e-19Kinesin motor domain
DictyBaseDDB_G02931982.9992476920535046e-16kif10 on chromosome: 6 positio
n 2654607 to 2658323
Stentor CoeruleusSteCoe_348670.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00784600(coding)
ATGAAGAGAGTTCAATCTTAAGAGTAGCTTGGTTAAGAAAAAAGAGGAGGAGTTTAAGTG
TTTGTTAGGGTAAAACCCACATAAGATGGTGACCAAAGCATATTTTCAGGAGATGATGAA
AATGGTAGATCAGTTGTTGCCACTAAAACCCCTCAAAGATCAAGATAAATATAATATAGC
TACAAAAATGATAGAAGTTTAGAAAAGTTAAATGAAATATTTTAAGATAAGGCTGATGTT
TTCTTTTTTGATAATGTGTTTAGCCAAAAATCCAGCTAAGAAATCTTCTATCGCAAGACA
GCTAAAGAAGCAGTTTCAAACGTTGTTAGTGGATAAAACACTTCCATTTTGATACATGGT
CCATCAAGATGCGGAAAAACATATACTCTCACTGGTGCAGATAAACACTAAAAAGGATTG
ATGTTTAGATGTGTAGATGATCTTTTATCCAAAATAGATGTTGCCAATGAATAGGATTCC
TAATACAAATTATTCTTGTCTATTTTCTCAGTATACAATAATGAGATATTTGATCTTCTC
AGTAATGAGAATTCTGATTATTATGAAGTAATTGAGTATAGTCCAAATGATGTTAGAATT
GCAGGTATGTCAAGACATTTAATCAAATACAAGAGCGAATTTAAGAATAAATACGTGAAT
GCATTAAAGAAAATATAGTCTCTTAGCTAGCTTTTGAATGAAAAAAAGCTTTATGAAAAA
AGTCATATTGTTGTCCAGTTCAATGTTTCTGAAAGTGAATAAATAAATTTCAAACTCAAT
TTAGTAAGACTTGCAGATATTGATTTAGTAGATAAATAAATAAATGGAGATGATTTTGAG
GTTATCGAGCAATACATTAATTAAATCAATTAAAACACTTCATATTAAACTAGAGCTTAT
AAAAAGTGTAAATTAACTTCATGCATTAGAGATACAATTAATGAAAATACTCAATCTTTC
TTTATATCATGCGTTTCTTCATCATCTAATTAGTATGCTTAATCTCTTCTCTCATTAGAC
TATACATAAAGACTTTGTGCTTAGGGCTCACGCCTTCATGATGGAAATGAAATTAGAAGT
AGTTTTACTAGCAATTCTTAAAAAAGACTCCTTCCTAGCAGACCTCCTGTTTCACCAAAT
TCTGTAAAATCAAGCTTGATTGAAAACACTTTGAGACCTCAGCTCTCTTAATCAAATTTA
AGATAAAGCAATATTATTAATCAAAGTAGCACAGCTCCTAAATCAAATATTTAGAATTCT
CACATTGAGTTTATTGTTAATGAGTTGGAAAATATTTTTGAGGATATTCGTAAGCAATCA
CGTGTATTTGGAAGACTACCTGAAAGAGAAAGAAACGAATGGGTTAGCTAAAAAGAAATC
ATTTTAAACGATCTTTAGAGATAGATTGAGTTACAGCCCTACAGCAGAGATATTCCTTAT
TGCGAGACTCTTCTAACCAAGTGCTAAAGATAGTTAAGACTTATTAATCCTAGCTTAAGC
GATTAAAGATAAATTAGTGGTTCTCCTCCTTAAGGACATGTGAATAATTTAGGGCAAGGA
AAGCTAAATGGCTCATAAACAAATTTCTTTTAAGGAAATTTAAATAATAGCTTTTCTAGA
GTTAACCAACACAATAGAAGATAAAGTTAAGGAGGATATGCTGAAAAAGTAGGTCGCCTT
TCTCCTTCTCAAGAAAACAGATATAATGATTATGAGTTTTTAAAAGATAAAGAAGAAAAA
TTAGACAAAGACTTCATGCGCCTTCTTGATAGATATAATCACTCTAAGGAGCTGATTGAT
AGTCTCAGCAATCCTTAAGGATAATAATAGCACTCTCAATTAAATCAACCCTATCCATAG
TAATTGTAAAGAGTTTAGACTCAACCTTCTCTAGGATAACGCTCTCCTATTTAAAGTATT
ATCAGAAACAGCTAAATCCTCTAATCGCCTCAATAGAGATTAGCTGATATAAGCAATGTT
CATCAATAACTCTAAAATAATCAAGAAATGTATCGTACTCAAGATTCATCAGGATTTTTA
GACCAACCTCCTATCAATAAATCCAAGGTTGCAGTTTCTAGCAATATTGGAGAACTCAGT
CCTAATTTTGACTTACTTAATGCAGAAGAAAAAGAGAAAAATGTAGGAAAAAGCTTAAAA
AGACTAAAAGAAACAATTGAAATCAAAGAAAATATAGAAAAATCAAAAATATAAAAACTC
TAACTACTTAATAAAGACTTAAAACAAAGTTTAAGGGAATATGTCGAAAAATACGAGTAG
CTTTCTGATATTCTAAACAGCAAAGATGGTGAAATCGATAGATTGTAGTATGAGCTTAGG
TAAGCTTAAGAGGACATTCTTCTTAATGTTGATACAGTTAAAGAATTCAAAATAAAGGAA
TAAGGATGGCTACAGATGGAAGAGGAGCTCAGAGAATCAAATATACAATTAAAATCGAAG
CTACTCAAGAAGAAGAAGAAAGTCAATTAAATAAAGGAGGAATTTAGAAGAAAAGAAGAA
GAGCTTGCATTTTAGAAAAAATCACATGACCACGAAATAGAAAAGTACTAAAGAACTGTT
TAAGAGCATGAAGAAATCAAGTCAGTAGACCAAAACAAGGCAACTGCTCTTTCAGAAATA
GTTAATTAATTAAAAAATGACATGGATTAGAGAGAATAAGAATAAAAACAAGTCTTCTAA
AACTTACAGGAAATGAGATAGTTGAACTAAGAGCTCAACTAAAAATATCAAAATGAAGTT
ATTGAGAAGAATGAAACAGTAAATTAGAATCATGCTTTAACAAGAAAGAAAGAGGAGCTT
GAAGAACAAGTGCAAATTCTTGAATAAAAAATTTAAAAGCACAAATAAAAATTTGAAGAT
GAAAAATCCAAGCTAATGGAGGAGAGAAACTAAGAAAACTTGAAGAAAAAAGAAAAGATA
AAGTTTTTAAAAGCTTAATTAGCTGATAACGAGGACAAACACCAAGAAATTGAAGGTAAA
TACTAGCTTCTAATAAAGCAAGCTGACAACTTGGAAGCCTAGTTAAGAGAAACTTAAAAG
TACCTTAATGAATTAAAAGAAATAAAAGACGAATAAACTTATAAGATAGCCAAATTGACT
GAAGAGAAAAATAACTCTTATTTGGAGAATGAAAGATTATAAAATTTAGTTACCTCTTTA
GAGGGTAGGGTAGAAAAATTGGAGGCATCACAGTTGGGAGATGCTAAAACTATCAACGAG
CTAAAAGAACAAAGCAGCCGTTTGCAATCTGAGCTTAATGAAAAAGAAGATCAATTATAA
AAGGCTAACTAACACATTGATTAGTTACAAGAATAGTAAAACATCGAACTTAGCACTTTT
GAAATAAGATTAGACCAAGTTGTTCAGGAATTCACAGCCTGCAAGGAAGAAAACAATGAA
TTTAAGAGAAAGGAAATTGACAACAAGAAACTCCTTCAAAACTTAGAAGAATAAGTTGAA
AAGTATAAAGAAAAATACTTAAAGGCTAAACACTCAAATAAAAATCTACAATCTCATTTA
AAAGAACTAGAAAATCGTGTAAAAGATTACATGACTGAAAGATCTATAGAAGTTTAAGCC
TAAGCTCGTGAACGTGAAAGACAAACTAAAGTTGAATAAACTCAAAAGAATAAATTAAGA
ATTCTTGATGAAATTTAACAAATGATTAAAAGTCATAAACACAATTCCACAGTATAAAAA
TATGAAAATTGA


>TTHERM_00784600(protein)
MKRVQSQEQLGQEKRGGVQVFVRVKPTQDGDQSIFSGDDENGRSVVATKTPQRSRQIQYS
YKNDRSLEKLNEIFQDKADVFFFDNVFSQKSSQEIFYRKTAKEAVSNVVSGQNTSILIHG
PSRCGKTYTLTGADKHQKGLMFRCVDDLLSKIDVANEQDSQYKLFLSIFSVYNNEIFDLL
SNENSDYYEVIEYSPNDVRIAGMSRHLIKYKSEFKNKYVNALKKIQSLSQLLNEKKLYEK
SHIVVQFNVSESEQINFKLNLVRLADIDLVDKQINGDDFEVIEQYINQINQNTSYQTRAY
KKCKLTSCIRDTINENTQSFFISCVSSSSNQYAQSLLSLDYTQRLCAQGSRLHDGNEIRS
SFTSNSQKRLLPSRPPVSPNSVKSSLIENTLRPQLSQSNLRQSNIINQSSTAPKSNIQNS
HIEFIVNELENIFEDIRKQSRVFGRLPERERNEWVSQKEIILNDLQRQIELQPYSRDIPY
CETLLTKCQRQLRLINPSLSDQRQISGSPPQGHVNNLGQGKLNGSQTNFFQGNLNNSFSR
VNQHNRRQSQGGYAEKVGRLSPSQENRYNDYEFLKDKEEKLDKDFMRLLDRYNHSKELID
SLSNPQGQQQHSQLNQPYPQQLQRVQTQPSLGQRSPIQSIIRNSQILQSPQQRLADISNV
HQQLQNNQEMYRTQDSSGFLDQPPINKSKVAVSSNIGELSPNFDLLNAEEKEKNVGKSLK
RLKETIEIKENIEKSKIQKLQLLNKDLKQSLREYVEKYEQLSDILNSKDGEIDRLQYELR
QAQEDILLNVDTVKEFKIKEQGWLQMEEELRESNIQLKSKLLKKKKKVNQIKEEFRRKEE
ELAFQKKSHDHEIEKYQRTVQEHEEIKSVDQNKATALSEIVNQLKNDMDQREQEQKQVFQ
NLQEMRQLNQELNQKYQNEVIEKNETVNQNHALTRKKEELEEQVQILEQKIQKHKQKFED
EKSKLMEERNQENLKKKEKIKFLKAQLADNEDKHQEIEGKYQLLIKQADNLEAQLRETQK
YLNELKEIKDEQTYKIAKLTEEKNNSYLENERLQNLVTSLEGRVEKLEASQLGDAKTINE
LKEQSSRLQSELNEKEDQLQKANQHIDQLQEQQNIELSTFEIRLDQVVQEFTACKEENNE
FKRKEIDNKKLLQNLEEQVEKYKEKYLKAKHSNKNLQSHLKELENRVKDYMTERSIEVQA
QARERERQTKVEQTQKNKLRILDEIQQMIKSHKHNSTVQKYEN


>TTHERM_00784600(gene)
GAATCTAAATAATTCAATTTAATAAAAAAATCTATTGAAATACATATTTACATACAAAAA
TAGATAAAGATAAATTCAATGAAGAGAGTTCAATCTTAAGAGTAGCTTGGTTAAGGTAAT
TCACTGACTCAAAATTCTTAAAATTTATTAGGCAGTGCTAAATTAAATATTTATGAAAAA
GCAGAAAAAAGAGGAGGAGTTTAAGTGTTTGTTAGGGTAAAACCCACATAAGATGGTGAC
CAAAGCATATTTTCAGGAGATGATGAAAATGGTAGATCAGTTGTTGCCACTAAAACCCCT
CAAAGATCAAGATAAATATAATATAGCTACAAAAATGATAGAAGTTTAGAAAAGTTAAAT
GAAATATTTTAAGATAAGGCTGATGTTTTCTTTTTTGATAATGTGTTTAGCCAAAAATCC
AGGTAAATTTGCAACGTTAAATTGATCAGATTAACAAAGCAAGATAAGCGATGAAATTTA
TATTATTATGAAACTTTTTTCATTACTATAAAGATAAATAGTTTCATATCTAAATTTCTA
TTTTATCAAATAAAGCTAAGAAATCTTCTATCGCAAGACAGCTAAAGAAGCAGTTTCAAA
CGTTGTTAGTGGATAAAACACTTCCATTTTGATACATGGTCCATCAAGGTAGATTATTTA
AAATATATGAGCCAGCATTTTTAAAATAAAAGCATAAAATAACAAAAAATAAAAATAGTC
TTAGCTTTTTCATTTGCTAAAATACTTTTTATTTCTATATAAAGATGCGGAAAAACATAT
ACTCTCACTGGTGCAGATAAACACTAAAAAGGATTGATGTTTAGATGTGTAGATGATCTT
TTATCCAAAATAGATGTTGCCAATGAATAGGATTCCTAATACAAATTATTCTTGTCTATT
TTCTCAGTATACAATAATGAGATATTTGATCTTCTCAGTAATGAGAATTCTGATTATTAT
GTAAAAAAAAACTTGGCAATTTACAAAATTTAGGCAATACTTAATTGTCTCTTTATGTCT
CAATAAAATTTTAAATAATATTAAGACTATTTCAAACAATATTTTAATTGCTGTAAAATT
TAAATTTTAAAAGGAAGTAATTGAGTATAGTCCAAATGATGTTAGAATTGCAGGTATGTC
AAGACATTTAATCAAATACAAGAGCGAATTTAAGAATAAATACGTGAATGCATTAAAGAA
AATATAGTCTCTTAGCTAGCTTTTGAATGAAAAAAAGCTTTATGAAAAAAGTCATATTGT
TGTCCAGTTCAATGTTTCTGAAAGTGAATAAATAAATTTCAAACTCAATTTAGTAAGACT
TGCAGATATTGATTTAGTAGATAAATAAATAAATGGAGATGATTTTGAGGTTATCGAGCA
ATACATTAATTAAATCAATTAAAACACTTCATATTAAACTAGAGCTTATAAAAAGTGTAA
ATTAACTTCATGCATTAGAGATACAATTAATGAAAATACTCAATCTTTCTTTATATCATG
CGTTTCTTCATCATCTAATTAGTATGCTTAATCTCTTCTCTCATTAGACGTAAGCATTTC
TTTCGTTTTTTAATAAGCAATGAAATTATTTTTAAAGAACTAAAACCTTTTAAAATTATT
ATCAATATTCATTAAGCAAAAATTAATTTAAATTTAATAAAAACTAAGAAAAACAAATTA
ATTTTTTGTTATTATTTTTGATTTTAAATTAATTTTTGTTATTATTTTTGATTTTAAATA
AATAATTTTTAAACAGTATACATAAAGACTTTGTGCTTAGGGCTCACGCCTTCATGATGG
AAATGAAATTAGAAGTAGTTTTACTAGCAATTCTTAAAAAAGACTCCTTCCTAGCAGACC
TCCTGTTTCACCAAATTCTGTAAAATCAAGCTTGATTGAAAACACTTTGAGACCTCAGCT
CTCTTAATCAAATTTAAGATAAAGCAATATTATTAATCAAAGTAGCACAGCTCCTAAATC
AAATATTTAGAATTCTCACATTGAGTTTATTGTTAATGAGTTGGAAAATATTTTTGAGGA
TATTCGTAAGCAATCACGTGTATTTGGAAGACTACCTGAAAGAGAAAGAAACGAATGGGT
TAGCTAAAAAGAAATCATTTTAAACGATCTTTAGAGATAGATTGAGTTACAGCCCTACAG
CAGAGATGTAAGATTAATTATTTTAAAAAATAAATTAGAATATAATTAAAATTAAATGAG
ATTAAAGATTTTAAAATATAATTATTGAAACAGATTCCTTATTGCGAGACTCTTCTAACC
AAGTGCTAAAGATAGTTAAGACTTATTAATCCTAGCTTAAGCGATTAAAGATAAATTAGT
GGTTCTCCTCCTTAAGGACATGTGAATAATTTAGGGCAAGGAAAGCTAAATGGCTCATAA
ACAAATTTCTTTTAAGGAAATTTAAATAATAGCTTTTCTAGAGTTAACCAACACAATAGA
AGATAAAGTTAAGGAGGATATGCTGAAAAAGTAGGTCGCCTTTCTCCTTCTCAAGAAAAC
AGATATAATGATTATGAGTTTTTAAAAGATAAAGAAGAAAAATTAGACAAAGACTTCATG
CGCCTTCTTGATAGATATAATCACTCTAAGGAGCTGATTGATAGTCTCAGCAATCCTTAA
GGATAATAATAGCACTCTCAATTAAATCAACCCTATCCATAGTAATTGTAAAGAGTTTAG
ACTCAACCTTCTCTAGGATAACGCTCTCCTATTTAAAGTATTATCAGAAACAGCTAAATC
CTCTAATCGCCTCAATAGAGATTAGCTGATATAAGCAATGTTCATCAATAACTCTAAAAT
AATCAAGAAATGTATCGTACTCAAGATTCATCAGGATTTTTAGACCAACCTCCTATCAAT
AAATCCAAGGTTGCAGTTTCTAGCAATATTGGAGAACTCAGTCCTAATTTTGACTTACTT
AATGCAGAAGAAAAAGAGAAAAATGTAGGAAAAAGCTTAAAAAGACTAAAAGAAACAATT
GAAATCAAAGAAAATATAGAAAAATCAAAAATATAAAAACTCTAACTACTTAATAAAGAC
TTAAAACAAAGTTTAAGGGAATATGTCGAAAAATACGAGTAGCTTTCTGATATTCTAAAC
AGCAAAGATGGTGAAATCGATAGATTGTAGTATGAGCTTAGGTAAGCTTAAGAGGACATT
CTTCTTAATGTTGATACAGTTAAAGAATTCAAAATAAAGGAATAAGGATGGCTACAGATG
GAAGAGGAGCTCAGAGAATCAAATATACAATTAAAATCGAAGCTACTCAAGAAGAAGAAG
AAAGTCAATTAAATAAAGTAATTACTAAGAAACAAATAAATATTTTATTTTAAAATAAAT
TATAATCCTGAATAAACAAACTCACTCAAAATACTAAAAAAATAGGGAGGAATTTAGAAG
AAAAGAAGAAGAGCTTGCATTTTAGAAAAAATCACATGACCACGAAATAGAAAAGTACTA
AAGAACTGTTTAAGAGCATGAAGAAATCAAGTAAAATATTTTTTAGAAAATAGAAATAAA
ATATTAAAAATAAAATATATTTATAAAAATAGGTCAGTAGACCAAAACAAGGCAACTGCT
CTTTCAGAAATAGTTAATTAATTAAAAAATGACATGGATTAGAGAGAATAAGAATAAAAA
CAAGTCTTCTAAAACTTACAGGAAATGAGATAGTTGAACTAAGAGCTCAACTAAAAATAT
CAAAATGAAGTTATTGAGAAGAATGAAACAGTAAATTAGAATCATGCTTTAACAAGAAAG
AAAGAGGAGCTTGAAGAACAAGTGCAAATTCTTGAATAAAAAATTTAAAAGCACAAATAA
AAATTTGAAGATGAAAAATCCAAGCTAATGGAGGAGAGAAACTAAGAAAACTTGAAGAAA
AAAGAAAAGATAAAGTTTTTAAAAGCTTAATTAGCTGATAACGAGGACAAACACCAAGAA
ATTGAAGGTAAATACTAGCTTCTAATAAAGCAAGCTGACAACTTGGAAGCCTAGTTAAGA
GAAACTTAAAAGTACCTTAATGAATTAAAAGAAATAAAAGACGAATAAACTTATAAGATA
GCCAAATTGACTGAAGAGGTAAATATTTAGAAAAAAGAATCTAAATTTATATAAATAAAA
CCTATAAGTAAATAAAATGCAAAATATATTTTCCTGATGGAGCTTAAAAAGTTTTTGATT
ACTAAAAAATCGATTGAAATTTCTTTTATATGAACTTTTTATTAATTAAAAAAAAATATA
GAAAAATAACTCTTATTTGGAGAATGAAAGATTATAAAATTTAGTTACCTCTTTAGAGGG
TAGGGTAGAAAAATTGGAGGCATCACAGTTGGGAGATGCTAAAACTATCAACGAGGTATA
AAAATAAAAGAAATATTAATGTAAAGAATTTAATTTTATTTCTTATATGATTTCTGATCA
TCAAAAGCTAAAAGAACAAAGCAGCCGTTTGCAATCTGAGCTTAATGAAAAAGAAGATCA
ATTATAAAAGGCTAACTAACACATTGATTAGTTACAAGAATAGTAAAACATCGTAAATAT
TTTAAATTCAATTTATTATAATTTTTTATTAATTTTTTCTCATTAAACTTTTCTAAATAT
GAAAAAATGATATTAATTATTTTATTATTTAACATTTCCATTAAATTTAAATTTAACTTT
TAATACTTTTATGTGTTATATTTAATAATATCAATTTATTTCTAAAAAAAAGGAACTTAG
CACTTTTGAAATAAGATTAGACCAAGTTGTTCAGGAATTCACAGCCTGCAAGGAAGAAAA
CAATGAATTTAAGAGAAAGGAAATTGACAACAAGAAACTCCTTCAAAACTTAGAAGAATA
AGTTGAAAAGTATAAAGAAAAATACTTAAAGGCTAAACACTCAAATAAAAATCTACAATC
TCATTTAAAAGAAGTAAAAAATAAACAAGATTTAATTGAATTGCTTTTTAATCTTAATAT
TTTATTAATATAGCTAGAAAATCGTGTAAAAGATTACATGACTGAAAGATCTATAGAAGT
TTAAGCCTAAGCTCGTGAACGTGAAAGACAAACTAAAGTTGAATAAACTCAAAAGAATAA
ATTAAGAGTAAAATTTCACTAAACTCATTTTAAATTTAAATATTAAGCTTTATTCTTATT
AAAATAGATTCTTGATGAAATTTAACAAATGATTAAAAGTCATAAACACAATTCCACAGT
ATAAAAATATGAAAATTGA