Identifiers and Description

Gene Model Identifier

TTHERM_00941400

Standard Name

KDFA1 (KinetoDesmal Fiber Associate protein 1)

Aliases

PreTt25146 | 171.m00055 | DISA

Description

SF-assemblin domain protein; kinetodesmal fiber protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00941400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19589.13.0003580931682248e-179hypothetical protein (263 aa)
OxytrichaContig21276.0.g902.99915080840225e-45SF-assemblin/beta giardin
Stentor CoeruleusSteCoe_363066.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25533842: Galati DF, Bonney S, Kronenberg Z, Clarissa C, Yandell M, Elde NC, Jerka-Dziadosz M, Giddings TH, Frankel J, Pearson CG (2014) DisAp-dependent striated fiber elongation is required to organize ciliary arrays. The Journal of cell biology 207(6):705-15
  2. Ref:SUPR000289

Sequences

>TTHERM_00941400(coding)
ATGTCTGCTTTCGGCTCTCCTTTCCAATCTACTATTCACGGTCAATAAGAAGATTCACCC
AACAGAGTTAGAATAAAACTTCTTGGTGAAAAGTGGTAAAACATCTAACACAACATCGAC
CGTGAAAAACAAGATCGTAGAGATATTCTTGAAGAAAAGCTTAGAAATGTCGAAGATAAA
ATTAATTCTGAACGTCCTAATGACGAACAAAGATTTAAAGTATTAAAGGAGCAAGTTTTG
AAGCTTTAAAATACTCTTGAAGAAGAAAAGAATGGCAGAGAAGTTTTTGATGAAAGAAAG
GGTAAAGAAATTAAGATTCTTGATGAAAATTTACACAATCTTTTGGAAGAAGAAAAATCG
AGCAAAAGAATGGTTGAAAGCAACCTTTTGAAGCAAATCGATGAAAAGTTCTACAATATG
AACTTAAGTCTTTCCAAGAATAACAAGGCTTATGAAGAAAACACTGAAATTAAGCTTAAG
GAAGTTTAAGCCTAGATTGGATTTATTAAGGAACAAATCGATTTAGAAAAGAGAAAGAGA
GAAGAATCTACCAATGGTTTGACTGATGAGATCGAAAATGAATTGAATAAATTCCACGAT
GTCCTTCTTATTGAAAAGAAGGTTCGTGAAGAAACCCAAGCTAAAATATATAGAATGATT
GAAGATATCCACTCTAAGCTCCAAACTGAATTGGTCTAAGAAAAGAGAGACAGAGAATCC
ACAACTGAGTCTTTAATTAAACTCTTGGAAGACACTTGCTAGAGAATTGATAAGAACTTC
CGTCAATGA


>TTHERM_00941400(protein)
MSAFGSPFQSTIHGQQEDSPNRVRIKLLGEKWQNIQHNIDREKQDRRDILEEKLRNVEDK
INSERPNDEQRFKVLKEQVLKLQNTLEEEKNGREVFDERKGKEIKILDENLHNLLEEEKS
SKRMVESNLLKQIDEKFYNMNLSLSKNNKAYEENTEIKLKEVQAQIGFIKEQIDLEKRKR
EESTNGLTDEIENELNKFHDVLLIEKKVREETQAKIYRMIEDIHSKLQTELVQEKRDRES
TTESLIKLLEDTCQRIDKNFRQ


>TTHERM_00941400(gene)
ATGTCTGCTTTCGGCTCTCCTTTCCAATCTACTATTCACGGTCAATAAGAAGGTAAAGTA
TTTCATTTAATTTACTAGCAAGCCTATTCGGTGTCTAAAGTGAAACCATAAAAATGAAGC
TAGCTATCCATATTTTAAAATCTGTAGCCTTAGCAAATTATTAATTATTTTTCAATGATA
AAATTACTTAGATTCACCCAACAGAGTTAGAATAAAACTTCTTGGTGAAAAGTGGTAAAA
CATCTAACACAACATCGACCGTGAAAAACAAGATCGTAGAGATATTCTTGAAGAAAAGCT
TAGAAATGTCGAAGATAAAATTAATTCTGAACGTCCTAATGACGAACAAAGATTTAAAGT
ATTTATTTTGCTACTAAATGAAATGATAAAATTTAAAAAGTAACAAATAATCATTATCTG
ATAAATAGGTATTAAAGGAGCAAGTTTTGAAGCTTTAAAATACTCTTGAAGAAGAAAAGA
ATGGCAGAGAAGTAAAGCATTTTATTAAAGACAAGTGAGTTTAATGTTGCTTCAACATAT
TTTAATCTAATTTTATAGGTTTTTGATGAAAGAAAGGGTAAAGAAATTAAGATTCTTGAT
GAAAATTTACACAATCTTTTGGAAGAAGAAAAATCGGTAAATAATTTATTTATTAGCAAG
CAAACAAACAAACAACAACATCTTTGAAAAACATAGCAAAACTAATTTATTGATGAATAC
TTTAACAATAAATGGAATCACTTAGTTGATTTTGTTCAGCATATTATAATTAATCATTAT
TTAAAAGCAATAAATCTTATTTCTTAATAAAGCTTGAATAGGACGAATAAATAAATAAAT
ATTTAATAATTTTTTCTCCTTCTTATTTTAATTACTCACAAAAATTCACTGCTCGTAATA
TAAAATTTGAAAATAAGAAATTTTAAAATAAATTAAATTGAGCAGTAGATATGGCTTAAA
TTATAAATAAATCAGACATGCATACATATATGCACGATAATCACAAATTGCTTGATTTAT
ATATAGATAAATAAATAAATACCAAGAACCAATTTTAAATTAAATAAAAATTTATTTTTT
GAAATCTTTAAAATAAATAAATGCAAATGAAAATAGCTAGCTTTTATTATTAAACTAATA
TAAAAAAAATAATTAATACTAATATGACCTAATTAGAGAAAATCATATTGAAACACATTA
ATAAACTTTTAATAAATCTCATAATAATAAATAAGTGCATTGACTTATAATAAAATAAAA
ATTTATCAAAAATAATTATTTGAAAAATGAAATTAATTTTTGCTAGCTTTATGCAAAAAA
TAATTAATTTTATGAATTTTTTTAAACAAAATGTTGTCTTTTATGCTTTTAAACTAAATT
TAAAAATGAGGTTTAATGAGTTTTTTAAAATCGATTTAATTTTGAATACTTTTTTATGAT
TATTTAAATAAAATTATTTTTAATTTAAGAGCAAAAGAATGGTTGAAAGCAACCTTTTGA
AGCAAATCGATGAAAAGTTCTACAATATGAACTTAAGTCTTTCCAAGAATAACAAGGCTT
ATGAAGAAAACACTGAAATTAAGCTTAAGGAAGTTTAAGCCTAGATTGGATTTATTAAGG
AACAAATCGATTTAGAAAAGAGAAAGAGAGAAGAATCTACCAATGGTTTGACTGATGAGA
TCGAAAATGAATTGAATAAATTCCACGATGTCCTTCTTATTGAAAAGAAGGTTCGTGAAG
AAACCCAAGCTAAAATATATAGAATGATTGAAGATATCCACTCTAAGCTCCAAACTGAAT
TGGTCGTAAGATCTATTTTAATAATAAAATTTCCATTTTTGTAAGTGAATAGCTTTAAAT
GAATTATTTGAATAATTAACAGTAAGAAAAGAGAGACAGAGAATCCACAACTGAGTCTTT
AATTAAACTCTTGGAAGACACTTGCTAGAGAATTGATAAGAACTTCCGTCAATGA