Identifiers and Description

Gene Model Identifier

TTHERM_00188980

Standard Name

KDF4 (KinetoDesmal Fiber 4)

Aliases

PreTt08648 | 15.m00359 | 3697.m00071

Description

Kinetodesmal fiber protein; stability and/or synthesis of protein; localizes to basal bodies and premature oral apparatus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF06705 ) SF-assemblin/beta giardin

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00188980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40927.19.996360612176328e-173hypothetical protein (256 aa)
OxytrichaContig1313.1.g994.0017993270483566e-44SF-assemblin/beta giardin
Stentor CoeruleusSteCoe_308956.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21127172: Gould SB, Kraft LG, van Dooren GG, Goodman CD, Ford KL, Cassin AM, Bacic A, McFadden GI, Waller RF (2011) Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. Molecular biology and evolution 28(3):1319-31
  2. Ref:SUPR000352

Sequences

>TTHERM_00188980(coding)
ATGTCTTCCTACTCCTAAAATAGATTTATTCCTAACTCTCCTCATAATGATAGAATTTCA
AAAATTCAAGAAAAGCTTAACAGCATACAAATAGGTGTTGAGTCTGAACGTTACAGAAAA
TTTGAACAAGCCGAAAGCCATTTATGTGTCTTGGAAGAATAATTTTTTGAAGTACAAGGA
GACTTCGATAAGACTTTAAATAGCATTAGAGAAAATCTGATTAGATTCGAAAAAGTATTA
TAAGAAGAAAGAATAAATCATGACAGCTAAATTGATTAAGGCAACTAAGAAATTGCTTAG
ATCGAAAATAAGTTTGTTTAGGCTATTGAAAGCGAAACTGAGGCTCGTAAGGATTATGAA
GCTAAGGTCATCAGAAACTTAGAAGACAAGTACTCTTTCTTAAAGAACGAAATTTCAAAG
GAACAACTTTCTAGAAACTAATTTATCGATGAACTCTATCAAACTCTTTAATCTGATCTT
CCTAAGATTGAAGGAGCCATTGAAAATGAAAAGCAAGAAAGAGAAGAAAACGATCAAGCC
ATGATGAAGACTGTTACATATGAACTTAGCCAAATTAACGAAATAGTTATTACATAGAAA
AAGCAACGTGAATAATCTGAAGCTGCTATATTCGATATGCTTAAGGATGTAGTTAATCGT
GTTAAAATTGAATTAGATAATGAAAAAAAGACAAGAGAAGAAACCGAAGATCATCTTTTA
ACATTATTAGAAGAAACATGTTCTAAACTTCAAACTGCTTCCCAATTTTGA


>TTHERM_00188980(protein)
MSSYSQNRFIPNSPHNDRISKIQEKLNSIQIGVESERYRKFEQAESHLCVLEEQFFEVQG
DFDKTLNSIRENLIRFEKVLQEERINHDSQIDQGNQEIAQIENKFVQAIESETEARKDYE
AKVIRNLEDKYSFLKNEISKEQLSRNQFIDELYQTLQSDLPKIEGAIENEKQEREENDQA
MMKTVTYELSQINEIVITQKKQREQSEAAIFDMLKDVVNRVKIELDNEKKTREETEDHLL
TLLEETCSKLQTASQF


>TTHERM_00188980(gene)
ATGTCTTCCTACTCCTAAAATAGATGTATGCCTCTTAAAATCATTTTGAATTTTGAATAG
TTAGAATATTAGCATTGCTGAGATTTAGCTATTATAAGCATCATTTTATTAATAATTTAT
ATTTTTATTAAATAGTTATTCCTAACTCTCCTCATAATGATAGAATTTCAAAAATTCAAG
AAAAGCTTAACAGCATACAAGTACATACATACTTAATCTAATAATATAAAATCTATTTTA
TTTAAGCACTTATTATCATAATACATTAACATGAATTAGATCAAGCAATTGGAGTTTATT
TATAAAAATTTTGTTTGAATTAATTAAGATAGGTGTTGAGTCTGAACGTTACAGAAAATT
TGAACAAGCCGAAAGCCATTTATGTGTCTTGGAAGAATAATTTTTTGAAGTACAAGGAGA
CTTCGATAAGACTTTAAATAGCATTAGAGAAAATGTAATATTTTGGAAACTAAATTAAAT
TTTTCAAAGCTGTTAATCAATTCTATAGCTTTGATTAAACATGAATACAAATTTATGCTT
AGCTTGTACATAAATTATAATAAGAAAATAATAAATTATTTTTTATAATAGCTGATTAGA
TTCGAAAAAGTATTATAAGAAGAAAGAATAAATCATGACAGCTAAATTGATTAAGGCAAC
TAAGAAATTGCTTAGATCGAAAATAAGTTTGTTTAGGCTATTGAAAGCGAAACTGAGGTA
TTCATTGATAAATTTTATCTTTTTATTATTTATTTTAATCACATAAAAACAAAAAAAAAC
ATTCATACAGTGAAAAATTGATTAATTAATTAAAAATTAACTAATTAATTAATTAATAAT
CTTTTTAAAACAAATCAATCACAAATAAATAATAATAATTTTTTATTTCAATTATTTCTT
TTTCATCTTGAATTTATTTTCAAATAAAAAATATTCAAGGATATTTCTTAGAATTCAAAA
ACTTTATTGGCTATCCTTAGATTTTACTTCCAAAAATATTAAATTTAATTTGATTCATGC
TTTTTAATAAACTAAATCAAAATTTAATATAAATAAAAACTATTTTATTTATTAATTCAC
AATAATTAAAAAAATTTGTAGTATTTAAATTTCAATTTTAAAAATAATTTTTCAGGCTCG
TAAGGATTATGAAGCTAAGGTCATCAGAAACTTAGAAGACAAGTACTCTTTCTTAAAGAA
CGAAATTTCAAAGGAACAACTTTCTAGAAACTAATTTATCGATGAACTCTATCAAACTCT
TTAATCTGATCTTCCTAAGATTGAAGGAGCCATTGAAAATGAAAAGCAAGAAAGAGAAGA
AAACGATCAAGCCATGATGAAGACTGTTACATATGAACTTAGCCAAATTAACGAAATAGT
TATTACATAGAAAAAGCAACGTGAATAATCTGAAGCTGCTATATTCGATATGCTTAAGGA
TGTAGTTAATCGTGTTAAAATTGAATTAGATAATGAAAAAAAGACAAGGTATTTATTTAT
TTACTTATTAATCATTATAATTAATTTGAAATTTTATTTAAATTTGATTGATTGATTTTT
TTATTTTTTATATTAGAGAAGAAACCGAAGATCATCTTTTAACATTATTAGAAGAAACAT
GTTCTAAACTTCAAACTGCTTCCCAATTTTGA