Identifiers and Description

Gene Model Identifier

TTHERM_00588900

Standard Name

KDF3 (Kinetodesmal fiber protein 3)

Aliases

PreTt24104 | 81.m00161 | 3726.m00038

Description

Kinetodesmal fiber protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF06705 ) SF-assemblin/beta giardin

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00588900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16932.17.00150717792659e-166hypothetical protein (272 aa)
OxytrichaContig21276.0.g902.000704504372864e-47SF-assemblin/beta giardin
Stentor CoeruleusSteCoe_290011.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000320

Sequences

>TTHERM_00588900(coding)
ATGATGAACAGTACCTACTCTCCTACTCCTAACTACAACAATTATTCTATCTTAGAAAGA
GATAGATCTACCATCCTCTCTCCTTCTAGAGTTAGATTAAACTAATTAAATGAAAGACTT
TCAAACATGCAATTACAATTAGAAGAGTCAACCATCATTAAAAAAGAAGTTTATGAAGCT
AGAATCAGAGCATTAAGAGAAAAAATCAATAAAAATGCCTATGATGATGAAGCAAAATTC
AAGCTTTTACAAGAATAAATTTTAAAGATCCAAGAAAATCTTAACAATGAAAAGGGTGCC
AGAGAAAACGTCGGTGAAAAGAGATTCAAGGAATATAAAACTATTGAAACCAAGTTTAAC
AATGAATAAGGAAAGGAAAAGCAAAGCAGAAAAGACTCTGAATAGAAAATCTTAAAGCAA
GTTGATGAAAAGATCTACTAAATGAGAGTCGATTTAAGCAGAGATAAAAGAGCCAGAGAA
GAATACGAAGAAAGAACTGCTCAAGAAGTAGGTGATGAAATCCTCCAATTATAAGAAGAA
ATCGACGAAGAAAGAAAAATTAGAGAAGAAGGTAATGAAATATTGATTAAAAGATTGGGA
GATGAAATTTTGAAATTCTAAGAAATCCTTGCTAACGAAAGAAAATAAAGAGAAGAAACC
TAAAATCACATGTTCAATATGCTCGAAGATATTAATAACAAACTCAGTCTTGATATCAAC
AACGAAAAAGTTGCAAGAGAAAACATGGAAGAAACTCTTCTTAAATTACTTGAAGAAACT
TGCTAAAGAGTTGAAGTTGCTATTAAGTTAAGTTGA


>TTHERM_00588900(protein)
MMNSTYSPTPNYNNYSILERDRSTILSPSRVRLNQLNERLSNMQLQLEESTIIKKEVYEA
RIRALREKINKNAYDDEAKFKLLQEQILKIQENLNNEKGARENVGEKRFKEYKTIETKFN
NEQGKEKQSRKDSEQKILKQVDEKIYQMRVDLSRDKRAREEYEERTAQEVGDEILQLQEE
IDEERKIREEGNEILIKRLGDEILKFQEILANERKQREETQNHMFNMLEDINNKLSLDIN
NEKVARENMEETLLKLLEETCQRVEVAIKLS


>TTHERM_00588900(gene)
ATGATGAACAGTACCTACTCTCCTACTCCTAACTACAACAATTATTCTATCTTAGAAAGA
GATAGATCTACCAGTACGCAAATATATATCTCAGGCAAATCTAATCATTTAAAAATATGT
TTTTATTTTAATAGTCCTCTCTCCTTCTAGAGTTAGATTAAACTAATTAAATGAAAGACT
TTCAAACATGCAATTACAATTAGAAGAGTCAACCATCGTAAGCAAGATTTATGTTATTTC
AAGACGCGTCATGATTTTATATTTAAAAGATTAAAAAAGAAGTTTATGAAGCTAGAATCA
GAGCATTAAGAGAAAAAATCAATAAAAATGCCTATGATGATGAAGCAAAATTCAAGGTTA
GATTCTTTCAAATAAAAATAATTAAACTATTTAGGTCATGTTAAAACTCTTTTTAAATTA
AAATAATAGCTTTTACAAGAATAAATTTTAAAGATCCAAGAAAATCTTAACAATGAAAAG
GGTGCCAGAGAAGTAAATATTTCTATTAAAATAAATAAGCAGTGGAGAAGAGAAAGAATT
AAGAAATCATTTATCTACTCACTCTTCTTCACATGAATGAATTAATTAATTAAGAAATTA
TGTAACTAACATTTTGGTAGATTAAATCGTTTTCAAATTTAAATTTTAAAGAACGTCGGT
GAAAAGAGATTCAAGGAATATAAAACTATTGAAACCAAGTTTAACAATGAATAAGGAAAG
GAAAAGCAAAGCAGAAAAGACTCTGAATAGAAAATCTTAAAGCAAGTTGATGAAAAGATC
TACTAAATGAGAGTCGATTTAAGCAGAGATAAAAGAGCCAGAGAAGAATACGAAGAAAGA
ACTGCTCAAGAAGTAGGTGATGAAATCCTCCAATTATAAGAAGAAATCGACGAAGAAAGA
AAAATTAGGTAAATTTCACATCTTATCTTGGATTGCATATTGCATTTCAATCGATTAAAT
TCATTTTTTAATAATCATCTATTCCCTAACAAAAATAGAGAAGAAGGTAATGAAATATTG
ATTAAAAGATTGGGAGATGAAATTTTGAAATTCTAAGAAATCCTTGCTAACGAAAGAAAA
TAAAGAGAAGAAACCTAAAATCACATGTTCAATATGCTCGAAGATATTAATAACAAACTC
AGTCTTGATATCAACGTAATTTTAGTTTAAAATTAATTTATTTTTAATTAAATAATAACT
TTCAAAATAAACAAACAAACAACTCAAACAAAATACTTTATTTATTTTTAAATATTAATT
AAAATAAATAAATAAATAAATAAATAAATACTTTCTAAACAACATTAGAACGAAAAAGTT
GCAAGAGAAAACATGGAAGAAACTCTTCTTAAATTACTTGAAGAAACTTGCTAAAGAGTT
GAAGTTGCTATTAAGTTAAGTTGA