Identifiers and Description

Gene Model Identifier

TTHERM_00497660

Standard Name

KAT3 (KATanin)

Aliases

PreTt06931 | 62.m00215 | 3715.m00076

Description

katanin p80 noncatalytic subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01344 ) kelch repeat protein
  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00497660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12714.19.997093137033517e-262hypothetical protein (795 aa)
OxytrichaContig8346.0.g102.0007467515522948e-59WD domain, G-beta repeat
Stentor CoeruleusSteCoe_218261.0806392777072785e-30
SGDYCR072C1.9994498063102785e-22RSA4 WD-repeat protein involve
d in ribosome biogenesis; may
interact with ribosomes; requi
red for maturation and efficie
nt intra-nuclear transport or
pre-60S ribosomal subunits, lo
calizes to the nucleolus
DictyBaseDDB_G02821893.0007793728221555e-22tupA on chromosome: 3 position
5574241 to 5576373
WormBaseWBGene000064744.001630327199692e-20locus:wdr-5.1 WD repeat-cont
aining protein wdr-5.1 statu
s:Confirmed UniProt:Q17963
protein_id:CAA85487.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00497660(coding)
ATGAAGCGTAGGAATGCTAAGCTGATTGACTTTTAAAATAATCCTGGTTGTAAGATTTTA
ACTGCTAAATTTGGTAATTAGTCAAAATCAATTATTGCTTCTGGTGATGATAAAAATAAC
ATTTGTTTATGGAAATTCTCAAACGATATACCCATAAAAAAATTTGCTGGTTAAAATTAG
ACAAACCATTAAATAGAAACAACAGCTGTTTAATTTAACCATAGCGATAATATTTTATAT
ACTGGAACAAATAGAGGTATCATAAGTGTCTTGGATTTAGAAGCATAAAAATTAAGTCAT
ACTCTCAAGGGACATGGAGGCGGAATTAGTTCCTTAGCAATATTTCCTTATGAAGATTAA
AAAAATTTGTTGATATCTGGTTCAATGGATACTAATATTAAAATTTGGGATTTAAGAACT
AAAGAATGTGTTCACTAATTTAAGGGTCATACTATGCTAGTTAATTGCTTGGCAGGTTCT
CCTGATGGAAAAATGATAGCATCTGGTGGGTCAGATAGTTAAGTGAGGCTTTGGGATTAA
ACTACAGGAAAATGTTCTAATATATTTACACTACACGATGCATCAGTAACATGCTTATAA
TTTAATCCTGTAGAAATGGCTTTAGCAAGCGCAAGTGCTGATAGAACAGTGAAGTATTAT
GACTTAGATACTTATACTCTAATAAGCTAAACTAAGCCAGAGGCTACTAGCATCTAAAAA
ATTTTGTTTAACGTTGATGGAGATGTTCTATTTAGTGCAGCACATGAAAGTCTAAAAGTA
TGGAACCTAGATAAAGATGGATTGCTTCTTGATAATGTAGAGTCTTAATGGAGAGGAATC
ATGGATATGTAAATTTCAGAGAATGAAGATAATATAATTGGCGTTACTTCATATTAATAA
AACTTTGCTTTATGGGTATGCCCTTTAAAATTAATAAATATGGATTCTTCTGAGCAAGCT
ATCAATAATTAACTAAACAGAGTAAAAACAGGTTAATAAAATAATTCTAATAATCCTCCT
TAAAGAAACTTCTTACCATAAATAGACCCCATAAAAGGAAAATCTCCTCCTACGGATGAT
AATACATACGCTAAAATTCATAGCCCAGAAAACCATCTTCCTGGAAACTAAAGATCATAT
TCAGAAATGCATTCAAATAATTATTAGAACAACTAAGATTATCAGTATTTAAATTAAGGA
TATCAAAATACTCCTCAAATATTGCAAACTAAAGTAGAGAGCTATCCTAATTTACCATAA
ATAAATAATAACAGTGTCCATCATAATCTACCAAACTAATATGGGTATGCAAAATAATAA
TCTTAAGAATAGTTTGGTTACCCTAATTAATAGTAGGTCACAAACCAAAATATGCTTCCT
CCAACAAAGAGCCCTTAAATCATTAATGCAGTAATTCACAATTAGTACTCAAACGATGAT
TAAATGTTAAATAAAAAGAAAATTGTTGAATAAGAAGAAGATGAACACATAAATGAAGCA
ATAATTAACAAATAATTTGAAGAACTCAACAACTAATCAAGAATTTATAATTAAATTCTT
CCTCCAAAAGAATAAATTAAAATTGAATCCAACCTAAGCTCCTAATCTTCAAAAGAGGAA
ATTGAAGAAGAAATAGAAACATAAGAAAATAATAAAAAACAAAAACCCAAACCTCAATCA
CACGATGCTGTTGATAGAAATTTTGTGTAACCTTAATCATCAGGAGAGTAGCCCTTAGAT
TAGTCAAGTCTATCTATAGTAGATTCAATAGCTTAAAGCTTTCATTTGAATGCTGTTTTT
GATTAATAGTAATAATAATTACTAAAGCAAACTGAATTTATTGGCGATATCTCCAAAGAA
CATCAAAAATTTTTGATACTCATGAATAATAGATTAAACTATGTAAAGCCAATATAACAT
TGGTGGAATTAGGGAAATTCAAAATCATCTTTATATGCAATAAGTTAATTATATGATCCT
TGTTATGTTATGGATGCTCTATAAATGACATTAAATATGAATAAATTATAATACGTAAAT
GTTGAAGGTGTTGGAACTTTACTCTAAAAATGCAAAATCTTGATTGAAAGCAAATATTAG
TCGCATATTAAATTTGGTTTAGAATTTGTAAAGAAGATATTAGAATAATACAGAGATGAA
TTAATTAATGTGAAGACTTTTTCATTAATGAGCAAGGTAGATTTAGCAAGAGAGGAAAGA
ATAAAAAAGTATAACTCATTGATAGATGAGTTAAGGTCTATCTAAAAAATTTCAAGAATA
AAAAAAATAGTTGAACGCAAAGCTAAAGAAGATATTGGTCAGCTAGCTAATTTAGTATTG
ACAGATTTGAATTATCTTTTCGGTAAATTAGACAATGCAGCTCAGTAAGTTTGA


>TTHERM_00497660(protein)
MKRRNAKLIDFQNNPGCKILTAKFGNQSKSIIASGDDKNNICLWKFSNDIPIKKFAGQNQ
TNHQIETTAVQFNHSDNILYTGTNRGIISVLDLEAQKLSHTLKGHGGGISSLAIFPYEDQ
KNLLISGSMDTNIKIWDLRTKECVHQFKGHTMLVNCLAGSPDGKMIASGGSDSQVRLWDQ
TTGKCSNIFTLHDASVTCLQFNPVEMALASASADRTVKYYDLDTYTLISQTKPEATSIQK
ILFNVDGDVLFSAAHESLKVWNLDKDGLLLDNVESQWRGIMDMQISENEDNIIGVTSYQQ
NFALWVCPLKLINMDSSEQAINNQLNRVKTGQQNNSNNPPQRNFLPQIDPIKGKSPPTDD
NTYAKIHSPENHLPGNQRSYSEMHSNNYQNNQDYQYLNQGYQNTPQILQTKVESYPNLPQ
INNNSVHHNLPNQYGYAKQQSQEQFGYPNQQQVTNQNMLPPTKSPQIINAVIHNQYSNDD
QMLNKKKIVEQEEDEHINEAIINKQFEELNNQSRIYNQILPPKEQIKIESNLSSQSSKEE
IEEEIETQENNKKQKPKPQSHDAVDRNFVQPQSSGEQPLDQSSLSIVDSIAQSFHLNAVF
DQQQQQLLKQTEFIGDISKEHQKFLILMNNRLNYVKPIQHWWNQGNSKSSLYAISQLYDP
CYVMDALQMTLNMNKLQYVNVEGVGTLLQKCKILIESKYQSHIKFGLEFVKKILEQYRDE
LINVKTFSLMSKVDLAREERIKKYNSLIDELRSIQKISRIKKIVERKAKEDIGQLANLVL
TDLNYLFGKLDNAAQQV


>TTHERM_00497660(gene)
ATGAAGCGTAGGAATGCTAAGCTGAGTAAATTTTAACTTCTTTTTTCTAAAAATATTTAC
AAGCATCCTTCAATTCAGATTCATTTTAAAAAACATGAATTTGATTGACTAATAAAAATG
AAAAATCATATTTTTTAATGACTGAAGAAGGTTTAGTTTATAGAATGGCATTTAAAAATA
TTGTTAAAATAATTAATGCATATATTTCATAATATTTTTGTTTTTAGTTGACTTTTAAAA
TAATCCTGGTTGTAAGATTTTAACTGCTAAATTTGGTAATTAGTCAAAATCAATTATTGC
TTCTGGTGATGATAAAAATAACATTTGTTTATGGAAATTCTCAAACGATATACCCATAAA
AGTAAAATCTAATCAATAATTTTAATAGCTAGCCATTTAATTTAAATTTAATTTTAAATA
ATTCGTAGAAATTTGCTGGTTAAAATTAGACAAACCATTAAATAGAAACAACAGCTGTTT
AATTTAACCATAGCGATAATATTTTATATACTGGAACAAATAGAGGTATCATAAGTGTCT
TGGATTTAGAAGCATAAAAATGTATAAAACTAGATTTTGTTACAAAAATTGTTTGCATAA
ACCTATTATTATTTTGAATAGTAAGTCATACTCTCAAGGGACATGGAGGCGGAATTAGTT
CCTTAGCAATATTTCCTTATGAAGATTAAAAAAATTTGTTGATATCTGGTTCAATGGATA
CTAATATTAAAATTTGGGATTTAAGAACTAAAGAATGTGTTCACTAATTTAAGGGTCATA
CTATGCTAGTTAATTGCTTGGCAGGTTCTCCTGATGGAAAAATGATAGCATCTGGTGGGT
CAGATAGTTAAGTGAGGGTATACTAATTCGCATTTATTAACTTAGCTAATTAACTTTAAA
ATTAATAATTTATTAAAAGCTTTGGGATTAAACTACAGGAAAATGTTCTAATATATTTAC
ACTACACGATGCATCAGTAACATGCTTATAATTTAATCCTGTAGAAATGGCTTTAGCAAG
CGCAAGTGCTGATAGAACAGTGAAGTATTATGACTTAGATACTTATACTCTAGTAAATAT
ATATTTATGAAAAAAGTATTTACAATATTGATATTAATTAGATAAGCTAAACTAAGCCAG
AGGCTACTAGCATCTAAAAAATTTTGTTTAACGTTGATGGAGATGTTCTATTTAGTGCAG
CACATGAAAGTCTAAAAGTAAATTAAAAGTTGCCATTTTAAAGAATGAAAAACTAGTTAA
TTAATTAAAATTTAATTAGGTATGGAACCTAGATAAAGATGGATTGCTTCTTGATAATGT
AGAGTCTTAATGGAGAGGAATCATGGATATGTAAATTTCAGAGAATGAAGATAATATAAT
TGGCGTTACTTCATATTAATAAAACTTTGCTTTATGGGTATGCCCTTTAAAATTAATAAA
TATGGATTCTTCTGAGCAAGCTATCAATAATTAACTAAACAGAGTAAAAACAGGTTAATA
AAATAATTCTAATAATCCTCCTTAAAGAAACTTCTTACCATAAATAGACCCCATAAAAGG
AAAATCTCCTCCTACGGATGATAATACATACGCTAAAATTCATAGCCCAGAAAACCATCT
TCCTGGAAACTAAAGATCATATTCAGAAATGCATTCAAATAATTATTAGAACAACTAAGA
TTATCAGTATTTAAATTAAGGATATCAAAATACTCCTCAAATATTGCAAACTAAAGTAGA
GAGCTATCCTAATTTACCATAAATAAATAATAACAGTGTCCATCATAATCTACCAAACTA
ATATGGGTATGCAAAATAATAATCTTAAGAATAGTTTGGTTACCCTAATTAATAGTAGGT
CACAAACCAAAATATGCTTCCTCCAACAAAGAGCCCTTAAATCATTAATGCAGTAATTCA
CAATTAGTACTCAAACGATGATTAAATGTTAAATAAAAAGAAAATTGTTGAATAAGAAGA
AGATGAACACATAAATGAAGCAATAATTAACAAATAATTTGAAGAACTCAACAACTAATC
AAGAATTTATAATTAAATTCTTCCTCCAAAAGAATAAATTAAAATTGAATCCAACCTAAG
CTCCTAATCTTCAAAAGAGGAAATTGAAGAAGAAATAGAAACATAAGAAAATAATAAAAA
ACAAAAACCCAAACCTCAATCACACGATGCTGTTGATAGAAATGTAATAATTTAAATTAT
CTTAAAACAATTTTATTATTATCATTTTATAATTTTTAAAATTAATTATTTATTTCTATT
TTATACAATCAAGTTTGTGTAACCTTAATCATCAGGAGAGTAGCCCTTAGATTAGTCAAG
TCTATCTATAGTAGATTCAATAGCTTAAAGCTTTCATTTGAATGCTGTTTTTGATTAATA
GTAATAATAATTACTAAAGCAAACTGAATTTATTGGCGATGTAATTGTTTTAGAATTTTA
TTAATTTAATTAAACTGTTTTTTTTAACTAAGATCTCCAAAGAACATCAAAAATTTTTGA
TACTCATGAATAATAGATTAAACTATGTAAAGCCAATATAACATTGGTGGAATTAGGGAA
ATTCAAAATCATCTTTATATGCAATAAGTTAGTAAAATATATTTTTTGTTTTAAAATAAC
TGAGAATTTGGATTTTTTTAAAATTGAATTTATATTTTTTGAAAAAAATGAACACATTTT
TTCAAATTGAGATGTTTGAATCTAATATTTATAATAATTTAGATTATATGATCCTTGTTA
TGTTATGGATGCTCTATAAATGACATTAAATATGAATAAATTATAATACGTAAATGTTGA
AGGTGTTGGAACTTTACTCTAAAAATGCAAAATCTTGATTGAAAGCAAATATTAGGTAAA
TTTGTATTAAAAATGATGAAATTTAACAAATTGTATAATTAAATTAAAGTCGCATATTAA
ATTTGGTTTAGAATTTGTAAAGAAGATATTAGAATAATACAGAGATGTAATTTTATTTAA
TTATATTATGTAAATTTATATCGTTTCTTGTAAAGGAATTAATTAATGTGAAGACTTTTT
CATTAATGAGCAAGGTAGATTTAGCAAGAGAGGAAAGAATAAAAAAGTATAACTCATTGA
TAGATGAGTTAAGGTCTATCTAAAAAATTTCAAGAATAAAAAAAATAGTTGAACGCAAAG
CTAAAGAAGATGTAAATCAATTTCATTAAAAATTTAATCCACTAATTGAATAAATAAATA
AATAGATTGGTCAGCTAGCTAATTTAGTATTGACAGATTTGAATTATCTTTTCGGTAAAT
TAGACAATGCAGCTCAGTAAGTTTGA