Identifiers and Description

Gene Model Identifier

TTHERM_00414230

Standard Name

KAT2 (KATanin )

Aliases

PreTt13501 | 45.m00146 | 3833.m00703

Description

katanin p60 catalytic subunit-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00414230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06067.19.997093137033517e-262ATPase, AAA family protein (53
9 aa)
OxytrichaContig455.1.g248.000194140818961e-170ATPase family associated with
various cellular activities (A
AA)
SGDYPR173C1.9993206333383003e-80VPS4 AAA-ATPase involved in mu
ltivesicular body (MVB) protei
n sorting, ATP-bound Vps4p loc
alizes to endosomes and cataly
zes ESCRT-III disassembly and
membrane release; ATPase activ
ity is activated by Vta1p; reg
ulates cellular sterol metabol
ism
WormBaseWBGene000213348.998448382613942e-77locus:vps-4 status:Confirmed
UniProt:Q9BL83 protein_id
:CCD68056.1
DictyBaseDDB_G02843471.0004671766404936e-76vps4 on chromosome: 4 position
1865073 to 1866634
Stentor CoeruleusSteCoe_264482.194878508014299e-72

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00414230(coding)
ATGAGTTATCTACTATCAAAAGTCCGCTCAGAAGGTGAATCTCGTATGAATGAAGAAAAG
AAAATTGCTGATCGTAAAAGAAACTTAATAGTGCTTATATTGAGATACCTAACAAACATT
GGGTATATAGAATCATCTTAAAAGCTTGAATCAGAATCTCATATAAGCCTTGACAGCTGG
GAAGTAGCAGACAATATAGATTTGTATTAAATAATTATGGAGTTTGAATAATACTATGAT
ATAAGATTTGGAAAGCTTCCTAAGCTAGTAAGAAAGGTTAATGATGACTAAAAAAAAAAG
ATGCCATCTTTTCCGAAGATATCTACTCCAACAAAAGCATCAAGCACTTCAAGCAATATA
AAATAAGAATTATAAAATAACAGCAATTCTAGCGTGAACAGCAATTTAAATACAACAGGA
TCTTCTACTTAAAGAGTAGGAAGTTAGCTAGGGGGTTTACCTCCAAAAAATTTAGCGCAG
AATGCAAATAAAAAAGTCAAATCGTAAAATAGCAGTTTGGATGAAAAAGGAGTAGACCAA
AATAACACACTTAATATGGAAATTTAGGGTTAATCAGCTCTTGGAGCTAAAAAAAATGAA
GAAGAATCTACTGAAAATAATTTTTTTGATGTTAGAGTATTAAAAGGAATGCCTGATTTT
GGTGATGTTTAAGAATTAAAAGAATTAGCTGCATATTTATAAAGGGATATACTAGTTGAA
AATCCAAATGTTAAATTTAAAGATATAGTTGGACTTGATGATGCAAAAAGATTGTTAAAA
GAGGCTGTTTAAATTCCTTTAAAATATCCTCATTTTTTCACTGGAATATTAGAACCTTGG
AGAGGAGTTCTATTATATGGACCACCAGGTACAGGTAAGACTATGCTTGCAAAAGCTGTG
GCCACAGAATGTGGAACAACATTTTTTAATATATCTGCCTCTTCTGTAGTAAGTAAATGG
AGAGGTGAATCAGAAAAGTTGATAAGAGTCCTCTTTGAATTAGCTAGACATTATTAGCCT
TCAACTATTTTCTTAGATGAATTAGATTCTATTATGTCGTAAAGAAAAGGAGGAGATAAT
GAACATGAAGGAAGTAGAAGAATGAAGACAGAGCTTTTAATATAATTAGATGGGCTGATG
AAAAACAAAGAAAGAGTTTTCTTATTAGCAGCAAGTAATTTACCATGGGATTTAGATGTA
GCAATGCTAAGAAGATTAGAAAAAAGAATTTTAGTTCCTCTTCCAAGTAAAGAAGCAAGA
TAAAATATGATTGAGTAATTTTTACCTGAAGGAATAGCATAAGATTTGAATTATCAAGAA
ATTAGTGAAGCATTAGAGAATTATTCAGGCTCAGATATAAAATTATTGTGTAAAGAAGCA
GCTATGAAACCATTAAGAAGACTTATAAATTAAATTGAAAAATCTAATATAGAATAAGAA
GATATGTAAAAAAATCGTAAGCAGAAATTTTAATAACAGCAATCAATCAATCCACAAGAA
GTAAAACCCGATCCTGTCACTAACGAAGATATTGTTGAGGCTCTTAAAACTACTAAGCCT
TCTTCTTTTATAAAAACATAAGCTTATGAAAAATGGGCTAAGGAACATGGTTCAGTTTGA


>TTHERM_00414230(protein)
MSYLLSKVRSEGESRMNEEKKIADRKRNLIVLILRYLTNIGYIESSQKLESESHISLDSW
EVADNIDLYQIIMEFEQYYDIRFGKLPKLVRKVNDDQKKKMPSFPKISTPTKASSTSSNI
KQELQNNSNSSVNSNLNTTGSSTQRVGSQLGGLPPKNLAQNANKKVKSQNSSLDEKGVDQ
NNTLNMEIQGQSALGAKKNEEESTENNFFDVRVLKGMPDFGDVQELKELAAYLQRDILVE
NPNVKFKDIVGLDDAKRLLKEAVQIPLKYPHFFTGILEPWRGVLLYGPPGTGKTMLAKAV
ATECGTTFFNISASSVVSKWRGESEKLIRVLFELARHYQPSTIFLDELDSIMSQRKGGDN
EHEGSRRMKTELLIQLDGLMKNKERVFLLAASNLPWDLDVAMLRRLEKRILVPLPSKEAR
QNMIEQFLPEGIAQDLNYQEISEALENYSGSDIKLLCKEAAMKPLRRLINQIEKSNIEQE
DMQKNRKQKFQQQQSINPQEVKPDPVTNEDIVEALKTTKPSSFIKTQAYEKWAKEHGSV


>TTHERM_00414230(gene)
ATGAGTTATCTACTATCAAAAGTCCGCTCAGGTAAATAGTTTTTGTTATAAGTTGACAAT
ATTTTAAACCATTTTAATAGATAAATAGACTTTTAAATATTATAACATAAGTATAATTTT
TGTTTTTACTATTTTAGAAGGTGAATCTCGTATGAATGAAGAAAAGAAAATTGCTGATCG
TAAAAGAAACTTAATAGTGCTTATATTGAGATACCTAACAAACATTGGGTATATAGAATC
ATCTTAAAAGCTTGAATCAGAATCTCATATAAGCCTTGACAGCTGGTAATAATCATGATG
ATATGTATTTCATTATTCAATATCTAACAATCATTATAAAAAGATTATATAAAAATAATT
ATAAAATAACAAAATTTCTAATATAGGGAAGTAGCAGACAATATAGATTTGTATTAAATA
ATTATGGAGTTTGAATAATACTATGATATAAGATTTGGAAAGCTTCCTAAGCTAGTAAGA
AAGGTTAATGATGACTAAAAAAAAAAGATGCCATCTTTTCCGAAGATATCTACTCCAACA
AAAGCATCAAGCACTTCAAGCAATATAAAATAAGAATTATAAAATAACAGCAATTCTAGC
GTGAACAGCAATTTAAATACAACAGGATCTTCTACTTAAAGAGTAGGAAGTTAGCTAGGG
GGTTTACCTCCAAAAAATTTAGCGCAGAATGCAAATAAAAAAGTCAAATCGTAAAATAGC
AGTTTGGATGAAAAAGGAGTAGACCAAAATAACACACTTAATATGGAAATTTAGGGTTAA
TCAGCTCTTGTAAAGAAGCATTTTAATTAAAAAAATAAAGAAAATATTCAATTATAATTA
GGGAGCTAAAAAAAATGAAGAAGAATCTACTGAAAATAATTTTTTTGATGTTAGAGTATT
AAAAGGAATGCCTGATTTTGGTGATGTTTAAGAATTAAAAGAATTAGCTGCATATTTATA
AAGGGATATACTAGTTGAAAATCCAAATGTTAAATTTAAAGATATAGTTGGACTTGATGA
TGCAAAAAGATTGTTAAAAGAGGCTGTTTAAATTCCTTTAAAATATCCTCATTTTTTCAC
TGGAATATTAGAACCTTGGAGAGGAGTTCTATTATATGGACCACCAGGTACAGGTAAGGT
AAGAAAATATTTAAATAGAGAGTTTATCTTATAAAATTTATTGTTCAAATAAATAGACTA
TGCTTGCAAAAGCTGTGGCCACAGAATGTGGAACAACATTTTTTAATATATCTGCCTCTT
CTGTAGTAAGTAAATGGAGAGGTGAATCAGAAAAGTTGATAAGAGTCCTCTTTGAATTAG
CTAGACATTATTAGCCTTCAACTATTTTCTTAGATGAATTAGATTCTATTATGTCGTAAA
GAAAAGGAGGAGATAGTAAGTTTCTTCTAATTTCAAATAAATTATTTTTTTCAAAAATTT
TAATAACAAAAAAATATTTAATTTTGTTTATAATAATTAAACAGATGAACATGAAGGAAG
TAGAAGAATGAAGACAGAGCTTTTAATATAATTAGATGGGCTGATGAAAAACAAAGAAAG
AGTTTTCTTATTAGCAGCAAGTAATTTACCATGGGATTTAGATGTAGCAATGCTAAGAAG
ATTAGAAAAAAGAGTAAAATATTGTTTTAATTTAAAAGAAAATAAATTCATTTAAAACCA
ATTTTTGAAAAATAAAAGATTTTAGTTCCTCTTCCAAGTAAAGAAGCAAGATAAAATATG
ATTGAGTAATTTTTACCTGAAGGAATAGCATAAGATTTGAATTATCAAGAAATTAGTGAA
GCATTAGAGGTAAATATATTTATTTAATAAAGAAAACTATTTTTTATTTTTATTTTAGAA
TTATTCAGGCTCAGATATAAAATTATTGTGTAAAGAAGCAGCTATGAAACCATTAAGAAG
ACTTATAAATTAAATTGAAAAATCTAATATAGAATAAGAAGATATGTAAAAAAATCGTAA
GCAGAAATTTTAATAACAGCAATCAATCAATCCACAAGAAGGTATGTTATTCTTAATCTT
TCAAATTTAAATAAGGAGTTTTTAATAAATAAAATCAAGTAAAACCCGATCCTGTCACTA
ACGAAGATATTGTTGAGGCTCTTAAAACTACTAAGCCTTCTTCTTTTATAAAAACATAAG
CTTATGAAAAATGGGCTAAGGAACATGGTTCAGTTTGA