Identifiers and Description

Gene Model Identifier

TTHERM_00322760

Standard Name

KAT1 (KATanin )

Aliases

PreTt15995 | 32.m00239

Description

katanin p60 catalytic subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( PF00515 ) tetratricopeptide repeat
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( PF09336 ) Vps4 C terminal oligomerisation domain
  • ( TIGR00179 ) UDP-N-acetylenolpyruvoylglucosamine reductase
  • ( PF07724 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00322760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10067.19.997093137033517e-262ATPase, AAA family protein (64
8 aa)
OxytrichaContig7897.0.0.g352.0004037638327014e-151ATPase family associated with
various cellular activities (A
AA)
WormBaseWBGene000031831.9993206333383003e-80locus:mei-1 Meiotic spindle
formation protein mei-1 stat
us:Confirmed UniProt:P34808
protein_id:CAB00052.1
SGDYPR173C1.0004671766404936e-76VPS4 AAA-ATPase involved in mu
ltivesicular body (MVB) protei
n sorting, ATP-bound Vps4p loc
alizes to endosomes and cataly
zes ESCRT-III disassembly and
membrane release; ATPase activ
ity is activated by Vta1p; reg
ulates cellular sterol metabol
ism
DictyBaseDDB_G02683344.000989088096131e-71DDB_G0268334 on chromosome: 1
position 714031 to 716367
Stentor CoeruleusSteCoe_285761.7785284761271306e-68

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00322760(coding)
ATGTCAAATTCAGATAAACAATTAGAAGATCTTAAAAATTACATCAGTTTAGCGAGAGAA
AGCGCATATTTCGGCAAGTATTCTGAAGCAATTAACACTTTTAAAAAGGGCTTAGAAGTT
GCTGGCATGTTCAAGGTAAAGGCTGTAGAATAATATGCTTAGTAGGTATGGGAAAAATTT
GTGCTAGACTTATAAGCAGAATTCGATATAATCTCTTAATTGCAAGCAGTTAACCACGGA
TTTAAACCTCAACCACCTAATGGAGCAAACAAATAAGCTAATAATTAGAATGGTTAATAA
GGATAATAATAAAATTAACTCGATCATGATAAAAAATATCCTTTTGGTATTAAACCTTTT
TCTCACTTCGAAGATAACAAAATGAACAATAACAATAATAACAATAATAATAATAATAAT
AATAATAATCCTTTTAGATAGCAAGATAAGAATTTCTTACACAATTAACAATACTAAAAC
AATTTACCTGATCAAAATATGCACAATAACTAAAACTACAATAACTTTTAAGCACCTCAT
CAATACAATATGAATAGATAAGGTGGACCTGGAATGTAAGGAAATTATGGTTAAAACAAT
TATCAAAGTAATAACCCTAGCAACTATGGATATAATGACTTTTAGGATAATCCCTCATAA
AATTTTAATAGCCCTAATATTGAATACAATTAAAGATAAAATAGAAACCCTGCCAATAAT
GATTAAGGTAATTAAGATCCTGACGTTTGGCCAGCTCCTCCTCCTAAAGTCAACAAAGCC
AATAAAGCCCCTTAGAAGAATAAAACCCCTATTTACAATTTAAAAGAACTTCAGTAAAAG
CAAAATGATAATAATAATAACAATAATGCTAAAAAAGATGATAAAGAAAAGGCTAAAAGA
GATTACAATAAACCATGGTAAAGAAATGCTTAGACTCCTCAAGCAAAGAAAAAAGGTGAT
GAAGGAGAGAAAAAATAAAGCTTCTTAAATTTTTGTTATCCAAACGGATAAGGTCCTGAT
TCCGATTTGATAGCAATGCTTGAAAGAGATGTAGTAGATTAAAATCCTAATATCAGCTTT
GACTAAATCGCAGAGCTTGATAAAGCTAAAGATATGCTTTAAGAGGCTGTTTTGCTTCCT
ATTCTGATCCCTTAATATTTTAGAGGTATTCGTAGACCTCTTAAAGGAGTTCTTATGTTT
GGTCCTCCTGGTACTGGTAAAACCATGTTAGCAAAAGCTGTAGCAACAACTGGTAAAACC
ACATTCTTTAATGTTTCTGCCAGTAGTTTGGCTTCAAAGTGGAGAGGTGATTCAGAGAAA
CTAGTCAGAATTCTTTTCGAGATGGCAAGGTACTATGCACCTAGTACTATATTTTTCGAT
GAGATAGATGCTATTGGTTCTAAAAGAGTAGATGGAGAGTGCGAAGCAAATAGAAAAATG
AAAGCTGAAATGCTCATTTAAATTGATGGTGTAAGCAGCTCTTCAACAGATGAAAAAGAT
AGAAAATAAGTTATGGTCTTGGCAGCCACTAATAGACCTTGGGATTTAGATGAAGCTTTA
AGAAGAAGACTCGAAAAAAGAATTTTAATTCCTTTACCTTCCACTGAAGGCAGAAAGCAA
TTATTTGAGTTGAATATGAGAGGTATTAAATGCTCGGATGACATAGACTGGGTTGAATTA
GTTGGTAAAACTGATGGTTATTCAGGTGCTGATATAGCAAGTCTTTGCAGAGAAGCAGCT
TTTATGCCTATGAGAAGAAAATTAATGAAAGAAGGTGGTTTTAAAAATATTGAAAACATA
GAAAATCTTGCCTAGGAAAGTGACATACCGTTAACATAAAAAGATTTCGAAGAAGCTTTA
AGAAATGTAAATAAATCAGTAAGCAACGATGATCTAGAAAATTTTGAAAAATGGATGGCA
GAATTTGGTTCTGTTTGA


>TTHERM_00322760(protein)
MSNSDKQLEDLKNYISLARESAYFGKYSEAINTFKKGLEVAGMFKVKAVEQYAQQVWEKF
VLDLQAEFDIISQLQAVNHGFKPQPPNGANKQANNQNGQQGQQQNQLDHDKKYPFGIKPF
SHFEDNKMNNNNNNNNNNNNNNNPFRQQDKNFLHNQQYQNNLPDQNMHNNQNYNNFQAPH
QYNMNRQGGPGMQGNYGQNNYQSNNPSNYGYNDFQDNPSQNFNSPNIEYNQRQNRNPANN
DQGNQDPDVWPAPPPKVNKANKAPQKNKTPIYNLKELQQKQNDNNNNNNAKKDDKEKAKR
DYNKPWQRNAQTPQAKKKGDEGEKKQSFLNFCYPNGQGPDSDLIAMLERDVVDQNPNISF
DQIAELDKAKDMLQEAVLLPILIPQYFRGIRRPLKGVLMFGPPGTGKTMLAKAVATTGKT
TFFNVSASSLASKWRGDSEKLVRILFEMARYYAPSTIFFDEIDAIGSKRVDGECEANRKM
KAEMLIQIDGVSSSSTDEKDRKQVMVLAATNRPWDLDEALRRRLEKRILIPLPSTEGRKQ
LFELNMRGIKCSDDIDWVELVGKTDGYSGADIASLCREAAFMPMRRKLMKEGGFKNIENI
ENLAQESDIPLTQKDFEEALRNVNKSVSNDDLENFEKWMAEFGSV


>TTHERM_00322760(gene)
ATGTCAAATTCAGATAAACAATTAGAAGATCTTAAAAATTACATCAGTTTAGCGAGGTAA
ATTTGTTTTTTAATCATTTGAATAAAATTATTATATGTAGAATACCCATCAGCATATTAA
CTAATTCTATTATTAATTATTAGAGAAAGCGCATATTTCGGCAAGTATTCTGAAGCAATT
AACACTTTTAAAAAGGGCTTAGAAGTTGCTGGCATGTAAATAGATTGCTTCAATATTGAA
ATTTAATATTACAAAACTTTCTTATGAAAATTAAGACTTGTTTGGTTAAAAAATATATCA
TTTTATCCAGAATAATTGATTTGCGATAAACAATATATATTTTTGTTTTTTTAAATAAAG
GTTCAAGGTAAAGGCTGTAGAATAATATGCTTAGTAGGTATGGGAAAAATTTGTGCTAGA
CTTATAAGCAGAATTCGATATAATCTCTTAATTGCAAGCAGTTAACCACGGATTTAAAGT
AAGCTTTATTCAATTTATGAGCATTAATAGAATCATTTTTTTGAATTAATTTATAAAGCC
TCAACCACCTAATGGAGCAAACAAATAAGCTAATAATTAGAATGGTTAATAAGGATAATA
ATAAAATTAACTCGATCATGATAAAAAATATCCTTTTGGTATTAAACCTTTTTCTCACTT
CGAAGATAACAAAATGAACAATAACAATAATAACAATAATAATAATAATAATAATAATAA
TCCTTTTAGATAGCAAGATAAGAATTTCTTACACAATTAACAATACTAAAACAATTTACC
TGATCAAAATATGCACAATAACTAAAACTACAATAACTTTTAAGCACCTCATCAATACAA
TATGAATAGATAAGGTGGACCTGGAATGTAAGGAAATTATGGTTAAAACAATTATCAAAG
TAATAACCCTAGCAACTATGGATATAATGACTTTTAGGATAATCCCTCATAAAATTTTAA
TAGCCCTAATATTGAATACAATTAAAGATAAAATAGAAACCCTGCCAATAATGATTAAGG
TAATTAAGATCCTGACGTTTGGCCAGCTCCTCCTCCTAAAGTCAACAAAGCCAATAAAGC
CCCTTAGAAGAATAAAACCCCTATTTACAATTTAAAAGAACTTCAGTAAAAGCAAAATGA
TAATAATAATAACAATAATGCTAAAAAAGATGATAAAGAAAAGGCTAAAAGAGATTACAA
TAAACCATGGTAAAGAAATGCTTAGACTCCTCAAGCAAAGAAAAAAGGTGATGAAGGAGA
GAAAAAATAAAGCTTCTTAAATTTTTGTTATCCAAACGGATAAGGTCCTGATTCCGATTT
GATAGCAATGCTTGAAAGAGATGTAGTAGATTAAAATCCTAATATCAGCTTTGACTAAAT
CGCAGAGCTTGATAAAGCTAAAGATATGCTTTAAGAGGCTGTTTTGCTTCCTATTCTGAT
CCCTTAATATTTTAGAGGTATTCGTAGACCTCTTAAAGGAGTTCTTATGTTTGGTCCTCC
TGGTACTGGTAAAACCATGTTAGCAAAAGCTGTAGCAACAGTAAGTTTTTTTAAAAATTA
TATAAAAATATTTTTTAAAAATAAATCTCAAAGAAAAAACATAAATTTTACATAAGAAAG
AAAGAATCATTTTAATATAAAAGTATAAATTTACTTTAAATATAAATAAAATGCCTAATT
TTTAAATTAAGTTTCTGGAATAAAAAAATAGAACTTTTATTTTTAATTTGTCTTTAAACA
AGCTCGCTCTAGAATTTTATTAATTTTGATTCTTGGCTCGTTCATTATCTAAAAATAAAT
TTACTAAATTTATTTTAGAAATTTTCTTTTATTTTACTTTTGAAAATATTTTTTGAACTA
AAAAAAAAATATTTTTGTTTTTACAAATTTTAATTTCAAAATTATTTTTTTTCATTTAAA
AAAAGACTGGTAAAACCACATTCTTTAATGTTTCTGCCAGTAGTTTGGCTTCAAAGTGGA
GAGGTGATTCAGAGAAACTAGTCAGAGTAAATTTCTCTATAACAAACTTTAATAAATAGG
ATTAATTTATTAATTCATTATTTAATTAGATTCTTTTCGAGATGGCAAGGTACTATGCAC
CTAGTACTATATTTTTCGATGAGATAGATGCTATTGGTTCTAAAAGAGTAGATGGAGAGT
GCGAAGCAAATAGAAAGTAAAAATTTAAATTTAAACTAATCTATATTTCTTAAACAAACA
ACTATGATAATAATTATATCTAAAATTAAGAATGAAAGCTGAAATGCTCATTTAAATTGA
TGGTGTAAGCAGCTCTTCAACAGATGAAAAAGATAGAAAATAAGTTATGGTCTTGGCAGC
CACTAATAGACCTTGGGATTTAGATGAAGCTTTAAGAAGAAGACTCGAAAAAAGAATTTG
TAATTCGAATAAAAAAGTGTAAATAAAAATAGTAATATATTTTTTAATCTATAAATAGTA
ATTCCTTTACCTTCCACTGAAGGCAGAAAGCAATTATTTGAGTTGAATATGAGAGGTATT
AAATGCTCGGATGACATAGACTGGGTTGAATTAGTTGGTAAAACTGATGGTTATTCAGGT
GCTGATATAGCAAGTGTAATTTATTTTTCATTTTTATTCTAAATTTAGCACAATTTCTTA
TGATTAAAATAGCTTTGCAGAGAAGCAGCTTTTATGCCTATGAGAAGAAAATTAATGAAA
GAAGGTGGTTTTAAAAATATTGAAAACATAGAAAATCTTGCCTGTAAGATTTTTATATTT
AAAAACTACATTAATATTGAAATTTTTTTTAAATAAAGAGGAAAGTGACATACCGTTAAC
ATAAAAAGATTTCGAAGAAGCTTTAAGAAATGTAAATAAATCAGTAAGCAACGATGATCT
AGAAAATTTTGAAAAATGGATGGCAGAATTTGGTTCTGTTTGA