Identifiers and Description

Gene Model Identifier

TTHERM_00527110

Standard Name

KAP104 (KAryoPherin 1)

Aliases

PreTt06443 | 66.m00242 | 3722.m00099

Description

Transportin or cytosolic karyopherin beta 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00527110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13438.19.997093137033517e-262importin-beta domain-containin
g protein (911 aa)
WormBaseWBGene000020765.0023264312997875e-87locus:imb-2 status:Partially
_confirmed UniProt:O62332
protein_id:CAB05586.1
OxytrichaContig15383.0.g274.0017545581927916e-85HEAT repeats
SGDYBR017C6.998168281769004e-37KAP104 Transportin or cytosoli
c karyopherin beta 2; function
s in the rg-nuclear localizati
on signal-mediated nuclear imp
ort/reimport of mRNA-binding p
roteins Nab2p and Hrp1p; regul
ates asymmetric protein synthe
sis in daughter cells during m
itosis
DictyBaseDDB_G02699489.99893167504554e-35tnpo on chromosome: 1 position
3916816 to 3919967
Stentor CoeruleusSteCoe_104841.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_00527110(coding)
ATGTTTTAGCCTGATATTGCAACACTTCAATAAGTTGCTTAGCTCTTATAGCAAGGCAAG
TTAGCTGACAATCAATAGCAAAAAGAAGTATATCAAAAAATAGAGGAATATTCTAAGTCC
CCTGAATTTTATAATTACTTATCCTACATTTTGGCTGCATAAAACAACCAAATTTAGCTT
GAGATTCGTCATATGGCTGGTGTTACATTAAAGTCGTTAGTAGAGAGAAATTTTGAGCAT
ATTCCTGAACAAAATATCTAGTTCATTAAGCAAAACTTGTTCTAGTCATTTAACGATTAA
TAAAAAGCCATTAGAAGCGCTATAGGTACTTTGATGACCACTATAATTTACAAGGGAGGA
TTTTAAAAATGGCCAGAATTGATTGAGTTTATGATCTAAAACTTAGAGTCCACAGACCAA
GGTGCTATTATTAACAGTATAGATTGCATTTCTAAAATCGTAGAAGATTTAAGAGTAAAC
TCTGAAAATTATGCATTTTTAGATTCTTCAAAGGGAGGATCTTAGCTCAACGTTTTGATT
CCTAAACTTTTTTCCTTCTGTGATCCAAAATATGGTACAGAAATACAATCAAACGCTATC
CACACATTGAACTTATGCGTTTAACCAATGCCTGCTGCTTTGGCAGAAAATTTAGATCAA
TATTTATAGATCCTCCTAAGCAACGTATAAAACAGTGAAAAGAGTATCAGACAAAGAGCT
TTCCAAGGAATTACAGCATTAACTGAAATAAGAAGAGACGCAATAATGAAAAGAATAAAT
CAAGTCATTCAATCAATCATTATTGGTAGTTAAGATGCTGAATATGATGTTGCTAAAAGT
GCCTGCAACTTCTGGTTTGAATATCTTGGTATGGAATAAAGTCCAGAAGACATATAACAA
AGTATGAAATGTGTTTAACCATACTTAAAAGATTTGCTTCCTGCTTTATTGAAGGGTCTT
TAATACACTGACGATGATTTAATGAATATTTTGCCTAGCACATAAAACATAAATAATAGA
CCTGAAATTTCAGAAGTAGGTGACATTGATGATTGTGATTTTGATGAAAATGAGAATTAA
TATGATTTTGAAGGAAATGATAATGAGAGAGAAACAAACGATTATGGTGAGTACACATTG
AGAAAAGTTTGTGGAAGAATTATATAAAAATTTTCATAGCAATTTAGAGATGACGTTTTC
CAAATTTTATAACCTTTAATTGAGCAATGCTTCTAGAGCAACGATTGGAAAATAAAAGAA
GTTGGCATAATTTGTTTAGGCGATATTTCTGAAGGAAGCATTAATTCTGTTTAGGTACAT
TTAGGAAATATAATTCCTTCATTGATATAGTTGTTCAATGTTCCTGGATAAAATTATCTC
CTTCAAACCTCAATTATGTGGACCATTTGTTAGTATAGAAGCTGGTTGATTGACAACTAC
AATTAATATTTCGATGTAATCAAAAGCTATTTGTAATGCATGGCTTTCGGAATCACTCAC
TAAATGCAACACTTGTAAGAGTGTTCTTGCCAGTGCTTAAAGGATTTTGTAGATAATGGA
TCTATGATTCTTAGACCATACTTGCACGATTTCATTAAAGTTGTTACTGAAGCAATTAAA
GTTTATTAAAACAGCAATTTAAATATGCTTTTAGATGCTGTGTGCACTATTGTTAGTACC
ATGTAAGAAGAAGTGAATACTCCAGAAGTCCTCCAAACACTACTTCCACCTATCCTTGAA
AAATGGGGATAACTCAAATCAACTGATATTGCTATAAAAGGATTTGCAGAATGCTTCTCT
CTTCTTGCTCAAGAATTAGAATCCAATTTCTTAATCTATACCGAATACATTTATCCTAAA
TGCTTTGAAATGTTACAAAATTATGTCATAGCTTTAAACACAGAAAGTAAAGATAGAAAA
CATATTAATTAAAAGAAGTAAATATTCCTTATGGGTACCGATCTCATGAGCAGCATAGTC
TATTGCACAAAATAAAACTTTGCTCTCCTTGCTCAACATACAGATTTAAACTCTATAATT
ATTAATACAATAGATTCTTAAGACAGTGAGGTTAGATCTTTCATATTCACCTTGATAAGT
GAAATTTCAATCCATTGTCCAAACTATATTGCATAAAAAGTAGAGATATATACTCAAATG
ATATCTTAGCATGTTATTCTTTTCCCACATTCCCTAGATCCCGGTAATTATTACTTGAAT
ACTTGCAATAATGCTGTACTTTGTCTCAACTAATTATGCATTAGTTATCCTGAAATAATG
AAACCTTATGCTTACCAAATAGCTTTAAAAATAATTAAAATTTTAGAAGAAACCAAAAAA
ATGGTTATTGATGTAGCCAGAAATGTATGTTGCTCTTTATGCTCCATAGCATTACTTGAT
TACTAAAACGTTAGTTAACATCTTTCTAGTTTCGTCTAAAAATTCTGTCTTAGTGTGAGA
TAATACAATGGATAATAAAAGAGAAGAGCTTTTGAGGGTTTATTCAAAATGGCATTCCAC
AATCCTAATGGTATCATTAATTATATGAGCTACATTGTTGATTCTTTCATAAGATACTAA
AACCCTCCATAGGAGTTGAAATTGTAATTCAAGACTCTGTTGATCGAATATAAAAAAACT
CTTAACGATGAACAGTGGTAAAACTTCCTTTTGAACAGTAATTTCGACTAAATAGTTATC
AAAAACTTAATTTAGCAATACCTTTCTTGA


>TTHERM_00527110(protein)
MFQPDIATLQQVAQLLQQGKLADNQQQKEVYQKIEEYSKSPEFYNYLSYILAAQNNQIQL
EIRHMAGVTLKSLVERNFEHIPEQNIQFIKQNLFQSFNDQQKAIRSAIGTLMTTIIYKGG
FQKWPELIEFMIQNLESTDQGAIINSIDCISKIVEDLRVNSENYAFLDSSKGGSQLNVLI
PKLFSFCDPKYGTEIQSNAIHTLNLCVQPMPAALAENLDQYLQILLSNVQNSEKSIRQRA
FQGITALTEIRRDAIMKRINQVIQSIIIGSQDAEYDVAKSACNFWFEYLGMEQSPEDIQQ
SMKCVQPYLKDLLPALLKGLQYTDDDLMNILPSTQNINNRPEISEVGDIDDCDFDENENQ
YDFEGNDNERETNDYGEYTLRKVCGRIIQKFSQQFRDDVFQILQPLIEQCFQSNDWKIKE
VGIICLGDISEGSINSVQVHLGNIIPSLIQLFNVPGQNYLLQTSIMWTICQYRSWLIDNY
NQYFDVIKSYLQCMAFGITHQMQHLQECSCQCLKDFVDNGSMILRPYLHDFIKVVTEAIK
VYQNSNLNMLLDAVCTIVSTMQEEVNTPEVLQTLLPPILEKWGQLKSTDIAIKGFAECFS
LLAQELESNFLIYTEYIYPKCFEMLQNYVIALNTESKDRKHINQKKQIFLMGTDLMSSIV
YCTKQNFALLAQHTDLNSIIINTIDSQDSEVRSFIFTLISEISIHCPNYIAQKVEIYTQM
ISQHVILFPHSLDPGNYYLNTCNNAVLCLNQLCISYPEIMKPYAYQIALKIIKILEETKK
MVIDVARNVCCSLCSIALLDYQNVSQHLSSFVQKFCLSVRQYNGQQKRRAFEGLFKMAFH
NPNGIINYMSYIVDSFIRYQNPPQELKLQFKTLLIEYKKTLNDEQWQNFLLNSNFDQIVI
KNLIQQYLS


>TTHERM_00527110(gene)
ATGTTTTAGCCTGATATTGCAACACTTCAATAAGTTGCTTAGCTCTTATAGCAAGGCAAG
TTAGCTGACAATCAATAGCAAAAAGAAGTATATCAAAAAATAGAGGAATATTCTAAGTCC
CCTGAATTTTATAATTACTTATCCTACATTTTGGCTGCATAAAACAACCAAATTTAGCTT
GAGATTCGTCATATGGCTGGTAAATACTCACTCACTTTTAGTCTTTTATAATAAATAACT
TATACTAAAATAATTTCTTTTTGCCCCCCAATTAAGCTATTTCTCATATCACATAAGAAA
ACATTTACCTAAATTGTTTATTTTATGATTTTAAAAAAATGGGTTTTAGTTATAATTTAT
TTTTTTATTTATTATTTTTTAAGCATGTCTAAAATTGATTCATATTTTATGCAAAAATAT
TTTGAATTTCAAAGCAAGGCTTAAATTTATTCTAATTTTAAAATATTTTGTTAGGTGTTA
CATTAAAGTCGTTAGTAGAGAGAAATTTTGAGCATATTCCTGAACAAAATATCTAGTTCA
TTAAGCAAAACTTGTTCTAGTCATTTAACGATTAATAAAAAGCCATTAGAAGCGCTATAG
GTACTTTGATGACCACTATAATTTACAAGGGAGGATTTTAAAAATGGCCAGAATTGATTG
AGTTTATGATCTAAAACTTAGAGTCCACAGACCAAGGTGCTATTATTAACAGTATAGATT
GCATTTCTAAAATCGTAGAAGATTTAAGAGTAAACTCTGAAAATTATGCATTTTTAGATT
CTTCAAAGGGAGGATCTTAGCTCAACGTTTTGATTCCTAAACTTTTTTCCTTCTGTGATC
CAAAATATGGTACAGAAATACAATCAAACGCTATCCACACATTGAACTTATGCGTTTAAC
CAATGCCTGCTGCTTTGGCAGAAAATTTAGATCAATATTTATAGATCCTCCTAAGCAACG
TATAAAACAGTGAAAAGAGTATCAGACAAAGAGCTTTCCAAGGAATTACAGCATTAACTG
AAATAAGAAGAGACGCAATAATGAAAAGAATAAATCAAGTCATTCAATCAATCATTATTG
GTAGTTAAGATGCTGAATATGATGTTGCTAAAAGTGCCTGCAACTTCTGGTTTGAATATC
TTGGTATGGAATAAAGTCCAGAAGACATATAACAAAGTATGAAATGTGTTTAACCATACT
TAAAAGAGTATATAATTGTTTTTTTTAAATTCAACTTTTAGTTAAAACTAAGAATTTTCT
TTAATTTAAAAGTTTGCTTCCTGCTTTATTGAAGGGTCTTTAATACACTGACGATGATTT
AATGAATATTTTGCCTAGCACATAAAACATAAATAATAGACCTGAAATTTCAGAAGTAGG
TGACATTGATGATTGTGATTTTGATGAAAATGAGAATTAATATGATTTTGAAGGAAATGA
TAATGAGAGAGAAACAAACGATTATGGTGAGTACACATTGAGAAAAGTTTGTGGAAGAAT
TATATAAAAATTTTCATAGCAATTTAGAGATGACGTTTTCCAAATTTTATAACCTTTAAT
TGAGCAATGCTTCTAGAGCAACGATTGGAAAATAAAGTAATTTCCTTTATAAGTCTTTGA
TATAAATTGTGTTATAAAAATCTTTTTTATTTTAAATTAATCAGAGAAGTTGGCATAATT
TGTTTAGGCGATATTTCTGAAGGAAGCATTAATTCTGTTTAGGTACATTTAGGAAATATA
ATTCCTTCATTGATATAGTTGTTCAATGTTCCTGGATAAAATTATCTCCTTCAAACCTCA
ATTATGTGGACCATTTGTTAGTATAGAAGCTGGTTGATTGACAACTACAATTAATATTTC
GATGTAATCAAAAGCTATTTGTAATGCATGGCTTTCGGAATCACTCACTAAATGCAACAC
TTGTAAGAGTGTTCTTGCCAGTGCTTAAAGGATTTTGTAGATAATGGATCTATGATTCTT
AGACCATACTTGCACGATTTCATTAAAGTATTTAATTTGAAGAGAATCGGATAATTATTT
TTTTTTGTTAACTGTAATAGGTTGTTACTGAAGCAATTAAAGTTTATTAAAACAGCAATT
TAAATATGCTTTTAGATGCTGTGTGCACTATTGTTAGTACCATGTAAGAAGAAGTGAATA
CTCCAGAAGTCCTCCAAACACTACTTCCACCTATCCTTGAAAAATGGGGATAACTCAAAT
CAACTGATATTGCTATAAAAGGATTTGCAGGTAAATTAGATTGAAATAACAAACAAGCAT
TTTAAGTTAAAATAAAATTATTAGAATGCTTCTCTCTTCTTGCTCAAGAATTAGAATCCA
ATTTCTTAATCTATACCGAATACATTTATCCTAAATGCTTTGAAATGTTACAAAATTATG
TCATAGCTTTAAACACAGAAAGTAAAGATAGAAAACATATTAATTAAAAGAAGTAAATAT
TCCTTATGGGTACCGATCTCATGAGCAGCATAGTCTATTGCACAAAATAAAACTTTGCTC
TCCTTGCTCAACATACAGATTTAAACTCTATAATTATTAATACAATAGATGTAATTAAAT
TAGTCATTATTTTCTGTTTATCAAAATTCTTTTTCTTAAAAAAAAGTCTTAAGACAGTGA
GGTTAGATCTTTCATATTCACCTTGATAAGTGAAATTTCAATCCATTGTCCAAACTATAT
TGCATAAAAAGTAGAGATATATACTCAAATGATATCTTAGCATGTTATTCTTTTCCCACA
TTCCCTAGATCCCGGTAATTATTACTTGAATACTTGCAATAATGCTGTACTTTGTCTCAA
CTAATTATGCATTAGTTATCCTGAAATAATGAAACCTTATGCTTACCAAATAGCTTTAAA
AATAATTAAAATTTTAGAAGAAACCAAAAAAGTATTTAAATTTAAAATTTGAATTTTATA
TTAATGTTCTTTACAAAAATAGATGGTTATTGATGTAGCCAGAAATGTATGTTGCTCTTT
ATGCTCCATAGCATTACTTGATTACTAAAACGTTAGTTAACATCTTTCTAGTTTCGTCTA
AAAATTCTGTCTTAGTGTGAGATAATACAATGGATAATAAAAGAGAAGAGCTTTTGAGTA
TTTATTTAGTTTTATTGTTTTCATTAATATATTTTATTAATTAATATAAAAAAGGGGTTT
ATTCAAAATGGCATTCCACAATCCTAATGGTATCATTAATTATATGAGCTACATTGTTGA
TTCTTTCATAAGATACTAAAACCCTCCATAGGAGTTGAAATTGTAATTCAAGACTCTGTT
GATCGAATATAAAAAAACTCTTAACGATGAACAGTGGTAAAACTTCCTTTTGAACAGTAA
TTTCGACTAAATAGTTATCAAAAACTTAATTTAGCAATACCTTTCTTGA