Identifiers and Description

Gene Model Identifier

TTHERM_00147500

Standard Name

Jinn2

Aliases

PreTt20608 | 12.m00282 | 3700.m00005

Description

Possible divergent subunit of Tetrahymena MuvB complex. Named after mythological creature 'Jinn' (or djinn). Other putative MuvB subunits include RebL1, Anqa1, Lin9 and Jinn1 (Nabeel-Shah et al.2021).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01784 ) conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00147500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04905.19.002272056803922e-129hypothetical protein (595 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00147500(coding)
ATGAGCTAAGATAAGGGAAAAAGTGAAGACAGTAGTTAAAAAAATAAAGATGTGAAGTTA
CCTTCAATTATTGATTAGCAATTAATAGCAACTTTATTGCAAAATATCAATTAAAATGCA
AGTTTAAATAATGAACTTGCTAACCTTAATCAATAATAAGATGAAGAATTTGATGAGAAC
GAGAGTAATCATAATAATAAAGATAAAAGTTAGGAAGAAGAAAATGATGATCAGGATAAT
AATTTAAGTTAAATGACGAGATAGAAGCAATTTTTTGATGCTGTTTTGTAGCAATACTAG
CTTATATAGCAGCAACAGCTTCAATCCCACGAATAAACTTAAAAATAAATTAATTAAAGG
ATGGAAGAGGAGGATGATGATGAAGAAAATTATTAGGAGGATGAAGAAGAAAACAATCAA
AACGAAGGCTAAATTGAAGAAAATAATAATTTAGATGGGAAAAAATAAGAAGAATTGAAA
TTAAAAATGTTAGGTAATAAAAAATAAGGAGAGCCTGATGAAGATTAGTAAAATTAGCTC
TTATAGCTTCTTATGAATTTAAATCCATCAAATAATGCACTTGCTCAACTTTAGCAATCA
GTTTAAAACTCAAATAATATAAATAGAAATAATAATTAGCTAGAAAAAAATATGAATAAA
ACTAATTAATAGATAGATAATCAAGATGAAAATGAAAACGAAGAAAATTATGAGGGTGAT
AATAACTAGTAGCCAATTAACATAAGTAAATTCGATTAATTAGAATTGACAAGATTGCTT
TAAGCTTAATATGATTAGTTGCATGCTGGGGAAGGAGACGAAGAATTAGAGCAATAAATA
AGTGGTTTTTAGGCTGAGTAAAATAATAAAAAATTCATGAAAAGATATGGTGAGATGACC
AATCAAATGGGAATGTAAAGAAATTTAATGTAACCAGAAGAAGATGAAGGAGAAGGAGAA
GAGGAAGAGGAAGAAGAAGCAAAATAAGCTTTGCATAATCAATATTTAGAAAAACAATGC
AAAGCATACTTAACCATGTAGCAACAGTAATAAGATTTAATGATTAATGAAATAAAAAAC
TTGGAATAATATTTAAGTGCTAATAATTTAACATAAGAATAAAGAAGTTTCGCTGAATAG
AAACAATAAATATTAATATTAAAATTGAAACAATTGCAGTAACATCTATAAGAAATCGCA
ATCAATCCAAATCTCGTTTTAGAATAAATTTAATTTTAACAAATGCAAAAGTAAGGCTTC
ATCGAACAGGATAATTTGATCGATTAGTAGAAAAAAGAATTTTTACTAAGAAATAATGCC
TTTATTAGGGGATCTGAATAAATAGGAAGAAGTTTATAATAGGCTTAGGACTAGGAACAA
GCTTAGCACTAGATGCAATATTAGTAATATATTTAATAGTAAGATAAGATGTAATAAAAT
AATAATTATTAAAATCACCCTCTCGTTAATTTTTTTAATTCATATTCCCTATTTATAAAT
GATACTGCTAATATTCAACTTGATCAAGAAGTTGTTCTAAATAAACTCATAGAAAATGCT
AAAAAATGCAAACCTCCTTCAAATGCTGATGAAAGAGTGAATTAACTGTGGAATTACCTT
ACTGATTTAGATAAAAAGTAAATTGAAGATTTCGAACAACAGCTTAAAAGCTTACCAGAA
TAAAATATCTACGAATGTATTTAGACAATTGAAAAACTTCACATAAAGCTATTAGTGGAG
TATAATATCGAAGTTGCTAGAGGAAAATAGTTAGGAATCATAAAACAATGA


>TTHERM_00147500(protein)
MSQDKGKSEDSSQKNKDVKLPSIIDQQLIATLLQNINQNASLNNELANLNQQQDEEFDEN
ESNHNNKDKSQEEENDDQDNNLSQMTRQKQFFDAVLQQYQLIQQQQLQSHEQTQKQINQR
MEEEDDDEENYQEDEEENNQNEGQIEENNNLDGKKQEELKLKMLGNKKQGEPDEDQQNQL
LQLLMNLNPSNNALAQLQQSVQNSNNINRNNNQLEKNMNKTNQQIDNQDENENEENYEGD
NNQQPINISKFDQLELTRLLQAQYDQLHAGEGDEELEQQISGFQAEQNNKKFMKRYGEMT
NQMGMQRNLMQPEEDEGEGEEEEEEEAKQALHNQYLEKQCKAYLTMQQQQQDLMINEIKN
LEQYLSANNLTQEQRSFAEQKQQILILKLKQLQQHLQEIAINPNLVLEQIQFQQMQKQGF
IEQDNLIDQQKKEFLLRNNAFIRGSEQIGRSLQQAQDQEQAQHQMQYQQYIQQQDKMQQN
NNYQNHPLVNFFNSYSLFINDTANIQLDQEVVLNKLIENAKKCKPPSNADERVNQLWNYL
TDLDKKQIEDFEQQLKSLPEQNIYECIQTIEKLHIKLLVEYNIEVARGKQLGIIKQ


>TTHERM_00147500(gene)
ATGAGCTAAGATAAGGGAAAAAGTGAAGACAGTAGTTAAAAAAATAAAGATGTGAAGTTA
CCTTCAATTATTGATTAGCAATTAATAGCAACTTTATTGCAAAATATCAATTAAAATGCA
AGTTTAAATAATGAACTTGCTAACCTTAATCAATAATAAGATGAAGAATTTGATGAGAAC
GAGAGTAATCATAATAATAAAGATAAAAGTTAGGAAGAAGAAAATGATGATCAGGATAAT
AATTTAAGTTAAATGACGAGATAGAAGCAATTTTTTGATGCTGTTTTGTAGCAATACTAG
CTTATATAGCAGCAACAGCTTCAATCCCACGAATAAACTTAAAAATAAATTAATTAAAGG
ATGGAAGAGGAGGATGATGATGAAGAAAATTATTAGGAGGATGAAGAAGAAAACAATCAA
AACGAAGGCTAAATTGAAGAAAATAATAATTTAGATGGGAAAAAATAAGAAGAATTGAAA
TTAAAAATGTTAGGTAATAAAAAATAAGGAGAGCCTGATGAAGATTAGTAAAATTAGCTC
TTATAGCTTCTTATGAATTTAAATCCATCAAATAATGCACTTGCTCAACTTTAGCAATCA
GTTTAAAACTCAAATAATATAAATAGAAATAATAATTAGCTAGAAAAAAATATGAATAAA
ACTAATTAATAGATAGATAATCAAGATGAAAATGAAAACGAAGAAAATTATGAGGGTGAT
AATAACTAGTAGCCAATTAACATAAGTAAATTCGATTAATTAGAATTGACAAGATTGCTT
TAAGCTTAATATGATTAGTTGCATGCTGGGGAAGGAGACGAAGAATTAGAGCAATAAATA
AGTGGTTTTTAGGCTGAGTAAAATAATAAAAAATTCATGAAAAGATATGGTGAGATGACC
AATCAAATGGGAATGTAAAGAAATTTAATGTAACCAGAAGAAGATGAAGGAGAAGGAGAA
GAGGAAGAGGAAGAAGAAGCAAAATAAGCTTTGCATAATCAATATTTAGAAAAACAATGC
AAAGCATACTTAACCATGTAGCAACAGTAATAAGATTTAATGATTAATGAAATAAAAAAC
TTGGAATAATATTTAAGTGCTAATAATTTAACATAAGAATAAAGAAGTTTCGCTGAATAG
AAACAATAAATATTAATATTAAAATTGAAACAATTGCAGTAACATCTATAAGAAATCGCA
ATCAATCCAAATCTCGTTTTAGAATAAATTTAATTTTAACAAATGCAAAAGTAAGGCTTC
ATCGAACAGGATAATTTGATCGATTAGTAGAAAAAAGAATTTTTACTAAGAAATAATGCC
TTTATTAGGGGATCTGAATAAATAGGAAGAAGTTTATAATAGGCTTAGGACTAGGAACAA
GCTTAGCACTAGATGCAATATTAGTAATATATTTAATAGTAAGATAAGATGTAATAAAAT
AATAATTATTAAAATCACCCTCTCGTTAATTTTTTTAATTCATATTCCCTATTTATAAAT
GATACTGCTAATATTCAACTTGATCAAGAAGTTGTTCTAAATAAACTCATAGAAAATGCT
AAAAAATGCAAACCTCCTTCAAAGTAAGAAATATTTTTAAACATTTTTGAAAGTTTCAAT
ACAATTTTTCATATGTATTTTTAAATAACTAAGCTAAAATAAAACTTCTATATTAGATAA
GGAAAAGCAAATAAATTAAAAATTTTAATTAAAAAGTATGAAGTAATTAGTTTAACTAGA
TATTCAAATAAAAGAATTTAATTACAAAAGAATTTAAAAAATATTATTTTTTATCCAAAA
GAAAAATATTTTACTATTAAAAGACGAAAATTAATCGATTAAGCTAAAATAATTACTCAA
GAAATAATTTTATTATTTTAATAAAAATAAAATTTTTTAATACACAAAAAAGCCTTTGTG
TAAATAAAATAAATGATAAAAAACATTCTAAAAGATGATCAGAATTATAATTTTAGTCTT
AGAAATACCAGAAAATGTTGATTAATAATTCCAAATTTAAAAACAGAATAAGCATTAATT
TTGACAAAAGTGATGTATTTAAAACAAGAAGTTAATTAATTATATAACCTTTTCCACTTT
TTACATCATAATCTGATTTTTTCTTATTAAAAATGATAATAAATTTTTTTGTTTCTTTCT
TTGATTTAATAAGGGACAAAAGGGTTTAAAAAAATTTCAAGTTTTAAAGGTTATAATTAT
AAATTTAATCAAGAGTAATTTCTTGTAAAAGAAAACAATACTTGCAATTGATTTCTAATG
AATTTTGACTTTTATAAGTATATTTAATATTTCTATGTAAAAAAAAAATCTTTTTTAAAA
GGCTAAAAATTTAATTCGGTTCTTTTTCAAAGAAATAGGCCTTATCGAATTCTAAAAAAA
TACATGTCAATATTTTAAAATCATTTTATAAATTTAATAGTGCTGATGAAAGAGTGAATT
AACTGTGGAATTACCTTACTGATTTAGATAAAAAGTAAATTGAAGATTTCGAACAACAGC
TTAAAAGCTTACCAGAATAAAATATCTACGAATGTATTTAGACAATTGAAAAACTTCACA
TAAAGCTATTAGTGGAGTATAATATCGAAGTTGCTAGAGGAAAATAGTTAGGAATCATAA
AACAATGA