Identifiers and Description

Gene Model Identifier

TTHERM_00227070

Standard Name

Jinn1

Aliases

PreTt12517 | 19.m00309

Description

Possible divergent subunit of Tetrahymena MuvB complex. Named after mythological creature 'Jinn' (or djinn). Other putative MuvB subunits include RebL1, Anqa1, Lin9 and Jinn2 (Nabeel-Shah et al.2021).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00225 ) C-terminal processing peptidase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00227070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05517.19.997093137033517e-262hypothetical protein (1022 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00227070(coding)
ATGTCCGACGCTGAAGGGAAGGGTTTGTCTGAGCAATAGACACGTAAAAGCAGCAGACAA
AAAACCCCCAACACATACTACAAGCAAGATATCTCCGATATTCGCGGCGAACCCAAGCCC
AAGCCCACCAAATAGCCGATCTAAAAAGCATCAAAGTCAAAGAAAAAATCCGATAAGACT
TCATCAAAGCAAGTCTTTAATAGCTCTTCAAATCCTTTGCTATTATAACAACAAGCACAA
GGAAAGTAGGCCTTTTCAAAGGAGAGCAGTAAATCTGTCGATAGAGATGATGATTCTGAA
AATGTTAATATTGATAAGGATGACGAGCCTATGGAAGTGGAGTCTGATCCTGCCTCTGAC
GCCCCAGAGGGATCAGAGCATCAAGACAGTCCTAGCTTGAGCTAAGAAGAAAGTAAGAAA
AGCTATTAAAACAATGCTAACACTAGCTATACCGAAAACGAAGACAATTCAAACAGACCC
GCTGGAGGCTACTAAACCCGCAAGATCCGCAAGAAACCAAAATTCGCTGATGACAACTAC
TTTGATAACGTCCCAGTTGCTAAAACCCAATAGCCTAAAAAGTAGAAGACAAATAAAGCT
CAACCAACTGCTGAGAACGCAAAAAAACCAAAGTAAATCAAAAAAGAAGGAGCTAGCGCA
ACTGGAGGAGAAAGCTAGAAACAAACTATCTCAAGCTAACAAAGTGAAAACGGTAATGCT
CCTACTATTAGCCAAGAAAAACCAACAGCTGGAGCAGCTTAGCTTAGTTAAACGGCCTAA
AATATAGCAAAAAATAGCTAAAAGCCCAATATGAAATAAACAGGAGTGAAAAAAGGCGAG
AAGCAAGAGAAATAAAATGAGGAGAAGAGCAAAGATACAACCAACGACAAGGCATTAAAA
GAGAAAAAAGATACTTAAAAGAAAGACAAAACAGACGATATTTTAAAAGTCGGACTCCTA
GACATCATTCTAGACGCAATTCATTAGGGTAATGAACCATAAGCTGAAGCTAAATAAAAT
TAGAATGCAAATAACTCAAGTAGCAATAATAACAATAATAGCTCGAATACAAATAATCAA
AATCAAAACCAAAATAATAACTCTAAATAATTTAATAACAATAATTAAATTAATGAAATG
TCTGCTTCTAATTTCTTAAATTTATTTAACAATGCCCTCAACGGAGCTTAATCAACGAAT
TAAAGTAGTAATAACTAATAGAATACAAGCAAGGGAAATAAAAGAAACAGTGAAGTAGAC
AAATAAAAATTAAATTAAATGGAAGATTAAACGACATAAAAGAAAAAATAAAAGACTTCA
AAGAAGGAAAAAAAAGATTAAGGCAATAGTGAAGGCAATAGTCAAGCTGCTTCTATGGAA
AACATTTAAATAGATCAAAAGAATAGCAAAAAAGGTGAAATCAGAAGTGTATCCACAAGT
ATTGAAAATGGAATTCCTAAAAATAATGAAAATATTCTTAGAGAAAGCAATGGAAACAAT
TAGCAATCAGTTTCTATTAATGGCACTATTTACAATTATCCCAATATTAATAGCAAATCA
GACTACATCACACATGTTGACAAAACCAAAGAGAAATTTATCCTTCATCACTCAAGCTTT
GAGCCTATGGTGATTAATAGAATCTTCTTAAAAGATGATGTATAAAAGAAAATTGATATG
CAACAATTGCTTTCTTAAATCACTCTTTAGTAGATTTAAAAGCAATAACAATAATAATCG
TAGCAAGCTATTCAAAAGCTTTATTAAGTAGCAAAGGAATAAGACACATAATAGTAATAA
AGCAACCCCCAACAAAACATATAATACGCCTTGAGCATGATCTCAAATATTTTATAGAAG
GGATAAAATTTTAATCAATAATAAAATAACAACTCATAGTAACAAGCTTAGTAATTGTAA
AATATGGTCAATTAACTAAATAATAATCCCATGGTTAGCAATGATAAAAACTCAGCTATT
TAGTAATTGCTATAAAGAACTTTAAATTAAAATGGATTTGCTAACAACAATATTAACAAT
TAGAATGGATTCAATATATTTGCTAACAGTACCAACTTCAATGAAATGTTTATGAGAGGA
CTTGATTAATTTAACTAATTCAATTAGACAGCTAATTAAATGAAGAATATGAATGGTAAC
AAAATCCCAAATAGTAATTTAATGGCAAATAAAAGCAGAAGCTAATCATAGGAATTTGAG
CCTTCATTAGCTTAAAGAAAATTATCAGAACACTTTAAGATTAACACTAAAAATAATGAT
GATGAAGTTTAATCTAATCACTCAGTTGCTGCTACAAGCAAACCACCCTCTCGCAAACCC
TCTATTTAAAACCCTTCAATCATTCAAGGAATTAAAGCAAACAGAGATGATAACTTATAA
GTAAAGAAAGAAATTAAAGAAGAAGCCACTTCTATTTAATAAAATTAAGGCAATAGCTTA
TTCGATGATAAAATAGAAAAAGCCCTTAATCAACTTGAAATGGAAATAGAAAACTAAAGA
AAAAACAGTATCAGTAAGCAAGAAGAAAAAATAAAAGAAGAAGCTTCTAAATAAATAGAA
AAGAAACAACCAATCAAAATGGAGATGGAAAGCAATTAAGAAAACACATAAAATTAAACT
GCTGTGCTTGAAAAAAGTAAAGAATAAAAATAAAAATTTGAAAAGAGCATAGCTGAAACT
GTCGAGGAAGACGATAATGAAAATGAAATTGAAATTGAATAGAATTTAGATGAAGATGAG
GATAGTGATGAAAATGACTAAGAAGAACAAAATAAAAATAATTAACAGTAATAATAAAAA
TAACCTAACAATATTGATGAAGCAAATAAGAATAATGCAAATGACTTTAATACTTCTTTG
TAGTCACAATTATTAGGATAATAACTATTAGAAATGCTCTTAAACAACATAAAGCCTTAA
ATACCAGAAATCAATGTTAAATCAGAAATAAAATAAGAGTTAGTGAATCATGTCTAACCA
CAATCATAAGAAGCATCCTCATAAAATAATTGA


>TTHERM_00227070(protein)
MSDAEGKGLSEQQTRKSSRQKTPNTYYKQDISDIRGEPKPKPTKQPIQKASKSKKKSDKT
SSKQVFNSSSNPLLLQQQAQGKQAFSKESSKSVDRDDDSENVNIDKDDEPMEVESDPASD
APEGSEHQDSPSLSQEESKKSYQNNANTSYTENEDNSNRPAGGYQTRKIRKKPKFADDNY
FDNVPVAKTQQPKKQKTNKAQPTAENAKKPKQIKKEGASATGGESQKQTISSQQSENGNA
PTISQEKPTAGAAQLSQTAQNIAKNSQKPNMKQTGVKKGEKQEKQNEEKSKDTTNDKALK
EKKDTQKKDKTDDILKVGLLDIILDAIHQGNEPQAEAKQNQNANNSSSNNNNNSSNTNNQ
NQNQNNNSKQFNNNNQINEMSASNFLNLFNNALNGAQSTNQSSNNQQNTSKGNKRNSEVD
KQKLNQMEDQTTQKKKQKTSKKEKKDQGNSEGNSQAASMENIQIDQKNSKKGEIRSVSTS
IENGIPKNNENILRESNGNNQQSVSINGTIYNYPNINSKSDYITHVDKTKEKFILHHSSF
EPMVINRIFLKDDVQKKIDMQQLLSQITLQQIQKQQQQQSQQAIQKLYQVAKEQDTQQQQ
SNPQQNIQYALSMISNILQKGQNFNQQQNNNSQQQAQQLQNMVNQLNNNPMVSNDKNSAI
QQLLQRTLNQNGFANNNINNQNGFNIFANSTNFNEMFMRGLDQFNQFNQTANQMKNMNGN
KIPNSNLMANKSRSQSQEFEPSLAQRKLSEHFKINTKNNDDEVQSNHSVAATSKPPSRKP
SIQNPSIIQGIKANRDDNLQVKKEIKEEATSIQQNQGNSLFDDKIEKALNQLEMEIENQR
KNSISKQEEKIKEEASKQIEKKQPIKMEMESNQENTQNQTAVLEKSKEQKQKFEKSIAET
VEEDDNENEIEIEQNLDEDEDSDENDQEEQNKNNQQQQQKQPNNIDEANKNNANDFNTSL
QSQLLGQQLLEMLLNNIKPQIPEINVKSEIKQELVNHVQPQSQEASSQNN


>TTHERM_00227070(gene)
ATGTCCGACGCTGAAGGGAAGGGTTTGTCTGGTAAATATGTTTCTACCTTGGTAAACAAC
TAAAATTAATATGATTTTAATATAGAGCAATAGACACGTAAAAGCAGCAGACAAAAAACC
CCCAACACATACTACAAGCAAGATATCTCCGATATTCGCGGCGTACATTAAAAAGCATTT
TCAGCCTTATAGTAAGCTCTAATCTCACCTTCTTATAAAAATAGGAACCCAAGCCCAAGC
CCACCAAATAGCCGATCTAAAAAGCATCAAAGTCAAAGAAAAAATCCGATAAGACTTCAT
CAAAGCAAGTCTTTAATAGCTCTTCAAATCCTTTGCTATTATAACAACAAGCACAAGGAA
AGTAGGCCTTTTCAAAGGAGAGCAGTAAATCTGTCGATAGAGATGATGATTCTGAAAATG
TTAATATTGATAAGGATGACGAGCCTATGGAAGTGGAGTCTGATCCTGCCTCTGACGCCC
CAGAGGGATCAGAGCATCAAGACAGTCCTAGCTTGAGCTAAGAAGAAAGTAAGAAAAGCT
ATTAAAACAATGCTAACACTAGCTATACCGAAAACGAAGGTAAATCCGGCATAAATACAA
GCGACTAGCACCTCTTCGTCCCTCCTTTGTCTTTTTATCAAATCATAAATTATTTTGATG
CCTAAAAATTTTCCTTAAGGGTAGGAATATTGGCTGATTAACAAGATAAGTTTGTTTGAT
ATAGATAATTAAAGTTTCCTACTTACATTTATAGTAGCAGATTTTCAAAATTTTTGCTAC
GTTTAAGGAAAACGAGACAAAAGAGAGACAATTGAGGCGCTAAGCGAGCAATTAATTTAA
GGAAAATATTTTTAAAAGTAAAATTTGTAATTTAAAAAACATAGACAATTCAAACAGACC
CGCTGGAGGCTACTAAACCCGCAAGATCCGCAAGAAACCAGTAATTCATTTATATTAATA
ATTTTTATAATTAAATTTCTTTTTTCTTTTAATCTTTTTTTAATGTTATATTTTGTAATT
TGATTTGCCTTTTTGTTGTCTTTATTCAATCAGGTTCTTATCTTTCTTTTATTTTTTCTT
CTTCTCCTCTTACTATCAATCTCTTTCTCACTAATTTCACTAACCTACTTTAGATTCATA
TAAAACAGCTTAAAAATTCATTCAATTTTACAAGCCCTCTTTGCACAAAAACACACGCAT
ACTATATTACCTCATTTATTTTACTCCATCTATACATTTTTCTACCTTCTGCTAATCTCA
ACGCTACATTTAATATACTACTCAGCATCTTTATATGCTTGGAATGCATTTAAATAAGGT
AGCTGCTAAAAATTTTATGCCTTAGGAGATAGTTCATTAAATTTTTTTTCGTTCATACTC
TGTAGTAGAGCTATATATAGATTATTAGAAAATGTAAAGCAGCAGTTAAATAAAATGATC
TCAACTAGTCAAAATAATACTAAAATATGTTTAAGTATCTTGAAAATAATAAAAAATGGA
GTTTTTGTAAATAAAAAGAACTTAAAACCGTTCGAATATAGCAACAAAGAAAGCAAATAT
GTTTGAAATAGTTATTTTAACTCTTCAGACTTACTTTTATATATCTTAATTTAAATATTT
TTTCCTTTTGTATAGAAATTCGCTGATGACAACTACTTTGATAACGTCCCAGTTGCTAAA
ACCCAATAGCCTAAAAAGTAGAAGACAAATAAAGCTCAACCAACTGCTGAGAACGCAAAA
AAACCAAAGTAAATCAAAAAAGAAGGAGCTAGCGCAACTGGAGGAGAAAGCTAGAAACAA
ACTATCTCAAGCTAACAAAGTGAAAACGGTAATGCTCCTACTATTAGCCAAGAAAAACCA
ACAGCTGGAGCAGCTTAGCTTAGTTAAACGGCCTAAAATATAGCAAAAAATAGCTAAAAG
CCCAATATGAAATAAACAGGAGTGAAAAAAGGCGAGAAGCAAGAGAAATAAAATGAGGAG
AAGAGCAAAGATACAACCAACGACAAGGCATTAAAAGAGAAAAAAGATACTTAAAAGAAA
GACAAAACAGACGATATTTTAGTAAATAAATAGATTTTTTGATCTAAAATAAGAAAAATA
AAAGATAATTAACATTTCATTAAAAATATAAATAGAAAGTCGGACTCCTAGACATCATTC
TAGACGCAATTCATTAGGTAAAACATTTTCTTGACATGATTTCAGCATCCCCTTTTAAAT
CTTATAAACTGTATATATTATTGGTGTGTAAATTTGTAAAGAAGAAGTAGGAGAATATGC
TCGTTGATTTTAATTAGCAATCAAAATAATAAATAAAGTATATTTTTTGTAAATCAATCG
ATGAATGAAAAAACAAAATTAATCTTTTTGCTCAAATTTTGTTTTGTTGTAGTTATTGGC
TGCGCTAAATATTATTAACATTATTAAATAATTAGCTATTAGTCTTCTTTTCACTCTCTC
GTAATCTAAAAAATAAAAGCATAAATAAATAAATAAATGATAAAGCCCAGCACATTCATT
CATTCATTCATAAATAATATATTTTTCTAAGCCTTTATCATTCATTTTAAAGCTAACTTT
AACTATTTTTAAATGCATATAATCAAATCCCCTAACAAAAGAATAAAAATACTCTTCTTT
TTTAATTCATTTGATAGTTAATTAATATACTAATTGATTAATTAATTCATCATTATTAGA
TTTTAATTCTACGCTTTTAATTCATTGATTAATTAAAAAGCAAACAATTTTCTATTTTGA
TTTACATACAAATTTTGAACATACAATAAATAAAGCAAATAAATACCTTCTTTTTTTCTA
TTCTACCTATCTATATCTATTTATTTATTTATCTTTCTTCTCATTTATTTCCAATAAAAG
ATCTTTACCCACCACTACCACAAATTTTGAATAATTAAAATTTATATTTGCAGAAAATTA
ATATAATACTTAACAAACAAAAACACTCCCCAAATTTCATTCTTTTTTTTTATTTGATCA
TTTCATTCCTCGCTACAAAAAATCATAGCCTATTTTCAAGCTAATAAATAAATTATATTT
AACTCGCTAAATTAATACTAGCCTTAAAAAATAAAAGCAAACTCTACATTTTCAAACACT
ACCAAATAAATTTATATTTTATACTTCTCACATTGTTTATTGTTTGGATATTATAACAAA
ATAAATATATTTTCACAAATAAAAATTTAAATAAAATAAATAAATATTTAAATCTTTCAA
AATAAAGCAAAATTTTTTATTAAAATTGATTGATCTTGATTTAATTTTTGCAATTTTTAA
ACACCAACATAGTTAAATTGATTTATTTAGTTAGAATATAACTTTTAAGAATTATTAATT
GTAAAATAAATTTTTATAATAGTGATATTTTATTATATAATTAGGGTAATGAACCATAAG
CTGAAGCTAAATAAAATTAGAATGCAAATAACTCAAGTAGCAATAATAACAATAATAGCT
CGAATACAAATAATCAAAATCAAAACCAAAATAATAACTCTAAATAATTTAATAACAATA
ATTAAATTAATGAAATGTCTGCTTCTAATTTCTTAAATTTATTTAACAATGCCCTCAACG
GAGCTTAATCAACGAATTAAAGTAGTAATAACTAATAGAATACAAGCAAGGGAAATAAAA
GAAACAGTGAAGTAGACAAATAAAAATTAAATTAAATGGAAGATTAAACGACATAAAAGT
AATTCATTAATTAATTGATTTGATTAAATTTAGATAGAGAAGATATTTATTTTACAAATT
AATTAAATAAAATGTTAAAAAAAAAATTTTGAATTAATAGGAAAAAATAAAAGACTTCAA
AGAAGGAAAAAAAAGATTAAGGCAATAGTGAAGGCAATAGTCAAGCTGCTTCTATGGAAA
ACATTTAAATAGATCAAAAGAATAGCAAAAAAGGTGAAATCAGAAGTGTATCCACAAGTA
TTGAAAATGGAATTCCTAAAAATAATGAAAATATTCTTAGAGAAAGCAATGGAAACAATT
AGCAATCAGTTTCTATTAATGGCACTATTTACAATTATCCCAATATTAATAGCAAATCAG
ACTACATCACACATGTTGACAAAACCAAAGAGAAATTTATCCTTCATCACTCAAGCTTTG
AGCCTAGTAATTAATATTTTAAAAACCTATAAAAAACATCTTTAAATAAATTTATTGAAA
TAATAAAATTAATTAATTCATTTTGAAAGTGATTTTTATTTGAAAAAATTAAATAATTTA
TTTTTAATTAATTAATTATTTAGTGGTGATTAATAGAATCTTCTTAAAAGATGATGTATA
AAAGAAAATTGATATGCAACAATTGCTTTCTTAAATCACTCTTTAGTAGATTTAAAAGCA
ATAACAATAATAATCGTAGCAAGCTATTCAAAAGCTTTATTAAGTAGCAAAGGAATAAGA
CACATAATAGTAATAAAGCAACCCCCAACAAAACATATAATACGCCTTGAGCATGATCTC
AAATATTTTATAGAAGGGATAAAATTTTAATCAATAATAAAATAACAACTCATAGTAACA
AGCTTAGTAATTGTAAAATATGGTCAATTAACTAAATAATAATCCCATGGTTAGCAATGA
TAAAAACTCAGCTATTTAGTAATTGCTATAAAGAACTTTAAATTAAAATGGATTTGCTAA
CAACAATATTAACAATTAGAATGGATTCAATATATTTGCTAACAGTACCAACTTCAATGA
AATGTTTATGAGAGGACTTGATTAATTTAACTAATTCAATTAGACAGCTAATTAAATGAA
GAATATGAATGGTAACAAAATCCCAAATAGTAATTTAATGGCAAATAAAAGCAGAAGCTA
ATCATAGGAATTTGAGCCTTCATTAGCTTAAAGAAAATTATCAGAACACTTTAAGATTAA
CACTAAAAATAATGATGATGAAGTTTAATCTAATCACTCAGTTGCTGCTACAAGCAAACC
ACCCTCTCGCAAACCCTCTATTTAAAACCCTTCAATCATTCAAGGAATTAAAGCAAACAG
AGATGATAACTTATAAGTAAAGAAAGAAATTAAAGAAGAAGCCACTTCTATTTAATAAAA
TTAAGGCAATAGCTTATTCGATGATAAAATAGAAAAAGCCCTTAATCAACTTGAAATGGA
AATAGAAAACTAAAGAAAAAACAGTATCAGTAAGCAAGAAGAAAAAATAAAAGAAGAAGC
TTCTAAATAAATAGAAAAGAAACAACCAATCAAAATGGAGATGGAAAGCAATTAAGAAAA
CACATAAAATTAAACTGCTGTGCTTGAAAAAAGTAAAGAATAAAAATAAAAATTTGAAAA
GAGCATAGCTGAAACTGTCGAGGAAGACGATAATGAAAATGAAATTGAAATTGAATAGAA
TTTAGATGAAGATGAGGATAGTGATGAAAATGACTAAGAAGAACAAAATAAAAATAATTA
ACAGTAATAATAAAAATAACCTAACAATATTGATGAAGCAAATAAGAATAATGCAAATGA
CTTTAATACTTCTTTGTAGTCACAATTATTAGGATAATAACTATTAGAAATGCTCTTAAA
CAACATAAAGCCTTAAATACCAGAAATCAATGTTAAATCAGAAATAAAATAAGAGTTAGT
GAATCATGTCTAACCACAATCATAAGAAGCATCCTCATAAAATAATTGA