Identifiers and Description

Gene Model Identifier

TTHERM_01415190

Standard Name

JUB6 (Junk buster 6)

Aliases

PreTt14740 | 376.m00013 | PRN1

Description

Prion-like protein Jub6p that is required for heterochromatin aggregation process during programmed DNA elimination

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_01415190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03361.14.998233068678632e-48hypothetical protein (568 aa)

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
COI6,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:27909245: Kataoka K, Mochizuki K (2017) Heterochromatin aggregation during DNA elimination in Tetrahymena is facilitated by a prion-like protein. Journal of cell science 130(2):480-489

Sequences

>TTHERM_01415190(coding)
AAATTTTATAAAAAAAAATAAATAAATAAATTAGTTATATTCATGATGGATTAAATAAAT
AATAGCAATATCTAAAACTAATTATTGTGCTTGAAGCACTATTAGCAATCAGAATACTTG
CAATTTGCCAGTGATAATGAAGAAGATCTATTTTGCTGCTACAATTGTTTGTATGAAGAG
TGTTATAAAGTAAAGAATATGATACCTTTAGAAAAAATTTAAAGTTGTGAAGAAGATCAT
ATTATATTTTCGTGGCCTCCTCTTGACGAGTAAGATTTAGTTTGTTAGATATACCAAATT
AGCCAATATGATAACCCTATTAGCATATAAAAGTTAATTTAATTTTTTGATGAATTAGAA
ACAGAAATTATAACTCATTTATAGAAATAAAAAAAGGCCTTTTTAGTAAAAATTAATAAT
ATTTCCACTTAAAATTAAGAATTATTAGATTTCTATTCTAAAATTTCTAAATTAAGTGAC
ATAAAAGGTATAATTTAGGATTAAAATCTAACTCAATTGCAAAAAGCTAAACAAGTATTA
GCTATTATCAACAAAATGAAAGAAAAGTCAACTGAAAACACACATAAACTTAAGCAAATG
CTTTAAAAATCAATTTAGTAAAAAGCTGTTGATTTATAATTGCTAACGAAGCTTAAAAAT
TCTATCTTAAAGTAACTCAGCTTCATTAACTCTCAATCTATGCAATAGCTGCAGTAATTT
CTTGAAAAGAATTACTGTTTGATAGAGCAATAAAAAAGTGAAAACAATTTACAGAATGAA
AACATAAAACTTTAAGAAAATGGAAATCTTGACACAATTTTAAAATTAGTTGCAAACAAA
ACAAATCAATGCGACTCAAAATACTTGGATTCACTTCAATCTGAGCTTCTCAAAATTTAA
GTCATAATAAATGACTTGAAAATAGAAAAGAATGTTTTTCTACCAAGCAAGCAATAAATC
AACTTTTAAGATTTTACTTAAGAGTAAATCGATGACATTCATTTGCTTAGTAAAAAAATA
AGCGAGATGAACAACAAATACAGATGCAGCTAAGAATAAGAAATTTTATCATTCAAAATT
TAACCATCTTCTTATTCTACTTGTAGAGCTTTGTTTAATTAAAACATAATTAAGCAAAAT
AAATTAAATTATTATTATAATTTACTAAAAAAATACCCTATTTTCGAGTTTGAAAGCTTT
TATAAGTCTTACTTTAATTGTAGATATTAATTACAACTTAGCTCTCTAAACAACAGCTAG
CAGTATGGACAAATAATTCAAAACAATTCAAATTATATATTCTAAGTAGTCCAGCAATCT
AACACTACCACTGCTTATATGAAAATAAACTAGGCTAGCTTGTATAGAGTAGTAGTTGAA
ATGAACCTCCATAATGTCTATAATAAGTATTACATTTTCGTTGGTCTTATAAGCAACTTT
AGTAAAGATAATACATATATTTCTGATGTGAACAAAGTCAACAGTTTTGCAGTTGATAGG
TAAAGCACAAGCAAAGGAGTTAGTAAAATCGTGAAAGGAAGGGTTCTAAAAGACTTACAG
TATCCCGATGATTACAAGCAGATAGAAATTACCTTTTGTGTTGAATCAAAGCTCTTTTAA
GTATGCGATTACCCTAACAGAGAAAATGTTAATGAAATTGATGACAACAGATTGTATCTG
TTAAATACCAGTTAAGAATATCTTTTAGGCTTTTAACTCTTTAATAACGGCGACAGCATA
ACCATTTTACAATGTGAAGAATTAGAGTACCAAAACTGA


>TTHERM_01415190(protein)
KFYKKKQINKLVIFMMDQINNSNIQNQLLCLKHYQQSEYLQFASDNEEDLFCCYNCLYEE
CYKVKNMIPLEKIQSCEEDHIIFSWPPLDEQDLVCQIYQISQYDNPISIQKLIQFFDELE
TEIITHLQKQKKAFLVKINNISTQNQELLDFYSKISKLSDIKGIIQDQNLTQLQKAKQVL
AIINKMKEKSTENTHKLKQMLQKSIQQKAVDLQLLTKLKNSILKQLSFINSQSMQQLQQF
LEKNYCLIEQQKSENNLQNENIKLQENGNLDTILKLVANKTNQCDSKYLDSLQSELLKIQ
VIINDLKIEKNVFLPSKQQINFQDFTQEQIDDIHLLSKKISEMNNKYRCSQEQEILSFKI
QPSSYSTCRALFNQNIIKQNKLNYYYNLLKKYPIFEFESFYKSYFNCRYQLQLSSLNNSQ
QYGQIIQNNSNYIFQVVQQSNTTTAYMKINQASLYRVVVEMNLHNVYNKYYIFVGLISNF
SKDNTYISDVNKVNSFAVDRQSTSKGVSKIVKGRVLKDLQYPDDYKQIEITFCVESKLFQ
VCDYPNRENVNEIDDNRLYLLNTSQEYLLGFQLFNNGDSITILQCEELEYQN


>TTHERM_01415190(gene)
AAATTTTATAAAAAAAAATAAATAAATAAATTAGTTATATTCATGATGGATTAAATAAAT
AATAGCAATATCTAAAACTAATTATTGTGCTTGAAGCACTATTAGCAATCAGAATACTTG
CAATTTGCCAGTGATAATGAAGAAGATCTATTTTGCTGCTACAATTGTTTGTATGAAGAG
TGTTATAAAGTAAAGAATATGATACCTTTAGAAAAAATTTAAAGTTGTGAAGAAGATCAT
ATTATATTTTCGTGGCCTCCTCTTGACGAGTAAGATTTAGTTTGTTAGATATACCAAATT
AGCCAATATGATAACCCTATTAGCATATAAAAGTTAATTTAATTTTTTGATGAATTAGAA
ACAGAAATTATAACTCATTTATAGAAATAAAAAAAGGCCTTTTTAGTAAAAATTAATAAT
ATTTCCACTTAAAATTAAGAATTATTAGATTTCTATTCTAAAATTTCTAAATTAAGTGAC
ATAAAAGGTATAATTTAGGATTAAAATCTAACTCAATTGCAAAAAGCTAAACAAGTATTA
GCTATTATCAACAAAATGAAAGAAAAGTCAACTGAAAACACACATAAACTTAAGCAAATG
CTTTAAAAATCAATTTAGTAAAAAGCTGTTGATTTATAATTGCTAACGAAGCTTAAAAAT
TCTATCTTAAAGTAACTCAGCTTCATTAACTCTCAATCTATGCAATAGCTGCAGTAATTT
CTTGAAAAGAATTACTGTTTGATAGAGCAATAAAAAAGTGAAAACAATTTACAGAATGAA
AACATAAAACTTTAAGAAAATGGAAATCTTGACACAATTTTAAAATTAGTTGCAAACAAA
ACAAATCAATGCGACTCAAAATACTTGGATTCACTTCAATCTGAGCTTCTCAAAATTTAA
GTCATAATAAATGACTTGAAAATAGAAAAGAATGTTTTTCTACCAAGCAAGCAATAAATC
AACTTTTAAGATTTTACTTAAGAGTAAATCGATGACATTCATTTGCTTAGTAAAAAAATA
AGCGAGATGAACAACAAATACAGATGCAGCTAAGAATAAGAAATTTTATCATTCAAAATT
TAACCATCTTCTTATTCTACTTGTAGAGCTTTGTTTAATTAAAACATAATTAAGCAAAAT
AAATTAAATTATTATTATAATTTACTAAAAAAATACCCTATTTTCGAGTTTGAAAGCTTT
TATAAGTCTTACTTTAATTGTAGATATTAATTACAACTTAGCTCTCTAAACAACAGCTAG
CAGTATGGACAAATAATTCAAAACAATTCAAATTATATATTCTAAGTAGTCCAGCAATCT
AACACTACCACTGCTTATATGAAAATAAACTAGGCTAGCTTGTATAGAGTAGTAGTTGAA
ATGAACCTCCATAATGTCTATAATAAGTATTACATTTTCGTTGGTCTTATAAGCAACTTT
AGTAAAGATAATACATATATTTCTGATGTGAACAAAGTCAACAGTTTTGCAGTTGATAGG
TAAAGCACAAGCAAAGGAGTTAGTAAAATCGTGAAAGGAAGGGTTCTAAAAGACTTACAG
TATCCCGATGATTACAAGCAGATAGAAATTACCTTTTGTGTTGAATCAAAGCTCTTTTAA
GTATGCGATTACCCTAACAGAGAAAATGTTAATGAAATTGATGACAACAGATTGTATCTG
TTAAATACCAGTTAAGAATATCTTTTAGGCTTTTAACTCTTTAATAACGGCGACAGCATA
ACCATTTTACAATGTGAAGAATTAGAGTACCAAAACTGA