Identifiers and Description

Gene Model Identifier

TTHERM_00442420

Standard Name

JUB3 (Junk Buster 3)

Aliases

PreTt05642 | 50.m00211 | 3681.m00070

Description

Heterochromatin Body Component Jub3p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00442420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12573.19.997093137033517e-262hypothetical protein (393 aa)

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
COI6,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00442420(coding)
ATGAGCTTTATAGAAAAAATAGAATATGAAATTGAAAAATATTTCCACTCAAGTGGTGTA
AAAGAAGGATTCGAAACTCTTTAAAATGATTTTAAATAATATACTCTTGAGAAAAATACC
TAATTCTAAGATATTAGGAAACACTTAGAGACTCTTTAATAAGAGAGCTTATAAACAGAA
ATTAAGATAGTCACTGAGAATTAAATAAAAGATGCTTGCTTTCTGTATATAGATGGAATT
AGCCTTATAGGAGTAGTGAGTAAAAATTAAATTTATGTCTTCTATTCAAGTGATTCAGCT
TCTTCAAACATAAATTTAATGTCTTAGCATACTATTTAATTTAACATAAGCGATAATCCC
TATTAGTACTAAAGTTATCCAAAGAGCAAGTAAAAAATAGTTAATTTCGTTAAAGGCTAC
AGAGAAAGCGTATTTCCTAAAACAGAAGAGGATTTATATTCTTGCGATTTCTTCGATTTG
CATTTAGAAAAAAATATTTACACTGGAGTTATTGCAGGAGGGATGACAGGTTTCATACAC
TTTGTTGACATTTAAAGTTCTACCAATTAAATTTGCTTTTAGGTGCATGGAGATACAATT
TTTGATATCAAATGCTTAAATAGAAATTAGTCATGCTAAGATTACAAAAATATAGTTGTT
AGTGCAAGTAAAGATGGTTCAATTTTTCTTTCTCATTTGGCTAAATAAGAAAAACTTATT
TAGCTTAAAGATTTTTTATCTACTTCTCCTATGTCACAATTTACGTGCATTGACATTGAC
TTAGCTTGCGAAAATATATTTTCCGCTTGTGGAGATGGAACAATTTAAGTTTGGCAGCTA
TCAGAATAAATAAAGAAAATTTTGCTTCTAAAAACTCCTGTGAATAACTTTGTAAAGATT
GAAAAATCTCAATACAATTACTAGGTATAAGCTTAAGAAGATATTATGCATACAGTTCAG
GTCACTTAGTGTAGTTTTTATGGAAAGTATTTACTTTATCTTAATAGCTAAGGATATATT
ACTCTCGGAACATTTATTGAACCATATGTTTACAAAGCTTAGTATCGCATGAGGAAGTTC
GACAAAGACAACACTGGTAAAAATCTGAAGTTTTTTCAAATTACTAATTTTGATTTAGGC
TCGAAAGTAGAAAACTATAACAAAGTCATGCATGTAGACTAAAAAAATGGTCTTGTATGG
ATAGGAAAACAATAGTCAATTTTTTGCTTTGACTTAAAAGATAGAAGGAACTCCGAAATC
GATTACAATTATAGCAAGCCTTTGATTGCTTACAATACTTTTATCAAGGCTAACATTTAG
AAGATATTTTTTAATGAAAATTACTCAGTTCTGTATATTCTTACTGATGCAAAATAGCTA
ATTAAATTCTCATTTATACCTAATAAGTGA


>TTHERM_00442420(protein)
MSFIEKIEYEIEKYFHSSGVKEGFETLQNDFKQYTLEKNTQFQDIRKHLETLQQESLQTE
IKIVTENQIKDACFLYIDGISLIGVVSKNQIYVFYSSDSASSNINLMSQHTIQFNISDNP
YQYQSYPKSKQKIVNFVKGYRESVFPKTEEDLYSCDFFDLHLEKNIYTGVIAGGMTGFIH
FVDIQSSTNQICFQVHGDTIFDIKCLNRNQSCQDYKNIVVSASKDGSIFLSHLAKQEKLI
QLKDFLSTSPMSQFTCIDIDLACENIFSACGDGTIQVWQLSEQIKKILLLKTPVNNFVKI
EKSQYNYQVQAQEDIMHTVQVTQCSFYGKYLLYLNSQGYITLGTFIEPYVYKAQYRMRKF
DKDNTGKNLKFFQITNFDLGSKVENYNKVMHVDQKNGLVWIGKQQSIFCFDLKDRRNSEI
DYNYSKPLIAYNTFIKANIQKIFFNENYSVLYILTDAKQLIKFSFIPNK


>TTHERM_00442420(gene)
ATGAGCTTTATAGAAAAAATAGAATATGAAATTGAAAAATATTTCCACTCAAGTGGTGTA
AAAGAAGGATTCGAAACTCTTTAAAATGATTTTAAATAATATACTCTTGAGAAAAATACC
TAATTCTAAGATATTAGGAAACACTTAGAGACTCTTTAATAAGAGAGCTTATAAACAGAA
ATTAAGATAGTCACTGAGAATTAAATAAAAGATGCTTGCTTTCTGTATATAGATGGAATT
AGCCTTATAGGAGTAGTGAGTAAAAATTAAATTTATGTCTTCTATTCAAGTGATTCAGCT
TCTTCAAACATAAATTTAATGTCTTAGCATACTATTTAATTTAACATAAGCGATAATCCC
TATTAGTACTAAAGTTATCCAAAGAGCAAGTAAAAAATAGTTAATTTCGTTAAAGGCTAC
AGAGAAAGCGTATTTCCTAAAACAGAAGAGGATTTATATTCTTGCGATTTCTTCGATTTG
CATTTAGAAAAAAATATTTACACTGGAGTTATTGCAGGAGGGATGACAGGTTTCATACAC
TTTGTTGACATTTAAAGTTCTACCAATTAAATTTGCTTTTAGGTGCATGGAGATACAATT
TTTGATATCAAATGCTTAAATAGAAATTAGTCATGCTAAGATTACAAAAATATAGTTGTT
AGTGCAAGTAAAGATGGTTCAATTTTTCTTTCTCATTTGGCTAAATAAGAAAAACTTATT
TAGCTTAAAGATTTTTTATCTACTTCTCCTATGTCACAATTTACGTGCATTGACATTGAC
TTAGCTTGCGAAAATATATTTTCCGCTTGTGGAGATGGAACAATTTAAGTTTGGCAGCTA
TCAGAATAAATAAAGAAAATTTTGCTTCTAAAAACTCCTGTGAATAACTTTGTAAAGATT
GAAAAATCTCAATACAATTACTAGGTATAAGCTTAAGAAGATATTATGCATACAGTTCAG
GTCACTTAGTGTAGTTTTTATGGAAAGTATTTACTTTATCTTAATAGCTAAGGATATATT
ACTCTCGGAACATTTATTGAACCATATGTTTACAAAGCTTAGTATCGCATGAGGAAGTTC
GACAAAGACAACACTGGTGTAAATTTCATATGATTAAAATGAAAATAAAAAATTTTAAAT
ATTTTAATTTATTTTTTTAAAAGAAAAATCTGAAGTTTTTTCAAATTACTAATTTTGATT
TAGGCTCGAAAGTAGAAAACTATAACAAAGTCATGCATGTAGACTAAAAAAATGGTCTTG
TATGGATAGGTATTTACTTCCTCTTAAAGTAAAAATGTTAAGTTTTTAATTAAAATAAAA
TTTAGGAAAACAATAGTCAATTTTTTGCTTTGACTTAAAAGATAGAAGGAACTCCGAAAT
CGATTACAATTATAGCAAGCCTTTGATTGCTTACAATACTTTTATCAAGGCTAACATTTA
GAAGATATTTTTTAATGAAAATTACTCAGTTCTGTATATTCTTACTGATGCAAAATAGCT
AATTAAATTCTCATTTATACCTAATAAGTGA