Identifiers and Description

Gene Model Identifier

TTHERM_000279929

Standard Name

JUB2 (Junk Buster 2)

Aliases

None

Description

Heterochromatin Body Component Jub2p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_000279929

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
HPL1,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_000279929(coding)
ATGTAGAATCAAATAATTAAGTACTTAGTTAACTTAGAAAAGGACTAGTTTATAAAGCGC
CTTTAAGAAAGTATAAAATTCATATAACAGGCAATATATTACAATAGTAAGTACCTAGAC
AATGAGCTTGAACTTTCTATTTGCTACTCTATGTTTTTTAGGGGATTAATTTACTAGCTG
AACTAGAGTCATAATTTTTTAAATACAAATGAATCAAGTATTTCTACAGAAAACATATGC
CTAATACCTAAGGAGAATTTGGATTTTAATGCCCAAGGAGTTAGCTTTCTAATTGTAATT
AAAGCTATACAAAGTAATGAGATGAGTTTAGATGAAGCATCAGAGTAATTATAGTTAAAA
GCTCAGTAAGGAATATAAGAAATATATTAAAATAAATTTGACTGTATACTTGAAAAATAT
AGCCCAAATTCTAATAAAGTATTTATATCTCTAGCTTTTTACAAAGACTTTGTTGATGTA
ATAATTAAATCAAAGCTAAATTAAGATTATGATAAATAAAATGAATGGAATAATATTCTT
AATCAAATCAATAAAAAATATAATTTAGAAACTGATTAACAAAAGGAAATTGCTAAATAA
AAAATTGTTAAAATATAATTTCTATAAAATAAAGTAGTACTTCCATAAAGTAAAGAAGAT
AATAATAAAGATGATATAGAAAAAATGAATAATTAATATGAAATTCTAAGTTTAAATTTA
TAGCAATTATAACAAAACAATTAAAGCACTTCAGATTCCTCTTAATAAGATGATAAAATT
GAAAGATTAAATTGTGAGAAAGAAAATGAGAATTTTGTTGAAGAACAAATATAAAAGAAA
GTAATTATTTTAAAAAAATCTTTGATTTTTAAGGAGGAAGAAAAATAAGACAATATTCAA
AAAGAAAAACGTCTAAATCTAAATTAAGATAATAATTCTATCTTAAAGTATGTTATAAAA
AAAGTATAGAGCAAAAAAATAGATTTAATTAAGAAATAAGTTAGATTTCTAGAGCAAAAA
AATTAAAAACCAAAAGAGTATAAGCAAGATTAGGTAAGCAGCAAGAGAAAACGTAAAAAT
AAAAAAGAATATAAATAAAAGTATACCAAAAAAATAAAAAAATGA


>TTHERM_000279929(protein)
MQNQIIKYLVNLEKDQFIKRLQESIKFIQQAIYYNSKYLDNELELSICYSMFFRGLIYQL
NQSHNFLNTNESSISTENICLIPKENLDFNAQGVSFLIVIKAIQSNEMSLDEASEQLQLK
AQQGIQEIYQNKFDCILEKYSPNSNKVFISLAFYKDFVDVIIKSKLNQDYDKQNEWNNIL
NQINKKYNLETDQQKEIAKQKIVKIQFLQNKVVLPQSKEDNNKDDIEKMNNQYEILSLNL
QQLQQNNQSTSDSSQQDDKIERLNCEKENENFVEEQIQKKVIILKKSLIFKEEEKQDNIQ
KEKRLNLNQDNNSILKYVIKKVQSKKIDLIKKQVRFLEQKNQKPKEYKQDQVSSKRKRKN
KKEYKQKYTKKIKK


>TTHERM_000279929(gene)
AAGAAAGACTCTCTAATAATTTGCTTTATTTATGTTTTTTAGAGCAGAAAATATTTTCAA
ATGAAAAATTATAATTAAAATTTAAAAAATTTTATTAAAAAATGTAGAATCAAATAATTA
AGTACTTAGTTAACTTAGAAAAGGACTAGTTTATAAAGCGCCTTTAAGAAAGTATAAAAT
TCATATAACAGGCAATATATTACAATAGTAAGTACCTAGACAATGAGCTTGAACTTTCTA
TTTGCTACTCTATGTTTTTTAGGGGATTAATTTACTAGCTGAACTAGAGTCATAATTTTT
TAAATACAAATGAATCAAGTATTTCTACAGAAAACATATGCCTAATACCTAAGGAGAATT
TGGATTTTAATGCCCAAGGAGTTAGCTTTCTAATTGTAATTAAAGCTATACAAAGTAATG
AGATGAGTTTAGATGAAGCATCAGAGTAATTATAGTTAAAAGCTCAGTAAGGAATATAAG
AAATATATTAAAATAAATTTGACTGTATACTTGAAAAATATAGCCCAAATTCTAATAAAG
TATTTATATCTCTAGCTTTTTACAAAGACTTTGTTGATGTAATAATTAAATCAAAGCTAA
ATTAAGATTATGATAAATAAAATGAATGGAATAATATTCTTAATCAAATCAATAAAAAAT
ATAATTTAGAAACTGATTAACAAAAGGAAATTGCTAAATAAAAAATTGTTAAAATATAAT
TTCTATAAAATAAAGTAGTACTTCCATAAAGTAAAGAAGATAATAATAAAGATGATATAG
AAAAAATGAATAATTAATATGAAATTCTAAGTTTAAATTTATAGCAATTATAACAAAACA
ATTAAAGCACTTCAGATTCCTCTTAATAAGATGATAAAATTGAAAGATTAAATTGTGAGA
AAGAAAATGAGAATTTTGTTGAAGAACAAATATAAAAGAAAGTAATTATTTTAAAAAAAT
CTTTGATTTTTAAGGAGGAAGAAAAATAAGACAATATTCAAAAAGAAAAACGTCTAAATC
TAAATTAAGATAATAATTCTATCTTAAAGTATGTTATAAAAAAAGTATAGAGCAAAAAAA
TAGATTTAATTAAGAAATAAGTTAGATTTCTAGAGCAAAAAAATTAAAAACCAAAAGAGT
ATAAGCAAGATTAGGTAAGCAGCAAGAGAAAACGTAAAAATAAAAAAGAATATAAATAAA
AGTATACCAAAAAAATAAAAAAATGAATGAAAATAAATAAACAATTTTATAATTTATAAA
ATTTTTAATTTTTTGTTAAATATTTACTTGTTTTTCATATTGTTAATTTAAATAAATCAA
ATGTTTGTTTCAACTACAATTC