Identifiers and Description

Gene Model Identifier

TTHERM_00576820

Standard Name

JSL5 (JUB6-like 5)

Aliases

PreTt28973 | 77.m00185 | 3812.m02660

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00576820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04042.11.0000297864968827e-159hypothetical protein (995 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27909245: Kataoka K, Mochizuki K (2017) Heterochromatin aggregation during DNA elimination in Tetrahymena is facilitated by a prion-like protein. Journal of cell science 130(2):480-489

Sequences

>TTHERM_00576820(coding)
ATGATTAATTAAGAAAAAGGAACCGACAAAATTCTACAAATATAAGAAATATTAAGTAGA
TAATGTCCTAAACATAATGAGTATCCTCTTGACCTTCTTTATATCACAAATAAATCTAAT
CAGCATGAAATTTGCTATATGTGTTTTTAGAGTTATCCAATAAAAAAAGAAGAAATTATC
AATATTAGATAGATTCTATTTGCAAAAGAAGATACTGTCCTTTAAAATTACCCTCCTTTA
GAGAATTAAAATTTGTATACTTAGTTGATTAATATTTTCAACGAATAAATGATCCTTGAT
TAATCAATCATTAAAATCTAGCAATTTTTCAAAGAGTTTGAAGAAAAGTTAATAGGTATT
ATTAAGCAATTACAAAGGGATATGGAAAATAAAATTGAAAATATAAAATATTTAAAAAAA
CAATTAGTTGAAACTTATAATTCTATTTCTTAAAAATCTGAATTAAAGAACTATTTTCAA
AATAACAACAAGGATAATTCTGCTCTGCACGATCTAATTTCTAAAAAATTTGACGAGTTA
CCAGAAAACACATAAAAAATAAAAGAATTAATAGATAAATTTAATACCTATAAAAGATCA
GTAAATTTCGATGGACCTGTTAAAATAGAAGAAGCAGTCATAAGTTTAATGAATTAAATA
GACTTTTTCTCAGACTTCAATGCTGAAAAATACACTTAAATAATATTTTAATAGGAGTTA
AACGATAATCATAAATACTAACTGTTAAATACAAGTAAACAAAAAAAGACAAATGTTGAT
TATTTGTTAGAACTTATTAAAAACTAGACAAATTATTGCAATAATTCAAGCTATGATGAA
ATTTAAAAGCTACTGAAAAAATATTCATTGCTTTTAAATTAAATTGAATTAAATTAACCA
ATTTGGGAAGAAGCTAAAAGAAATAGCTTCGTTAACCTTAGCGATTAGCAGCTAGAAAGA
GTAAGACTCATTTCAGAAAAGATTATTTCTATTGATAAATAATACGAAGAAAATGAAGCA
TCATCTTCACTTAAAGAAGACTCTGCTCTTTCAGATAAAAGCTTATAAAATTATTAGCCT
TACTGTTTGTAAGCTTGTATTTAACCTAATTCTTATGAAATATACAATAATTTGTTCAGT
GGAAAAGCAAGTTAGTATTAGAGATTTTAAAATTTATTAAAAGAGTACCCCATTTTTGAG
CTAGATAGTGTATAAGTTGGTTGCCATTAATTAATATTTTTTAATATGATAAAATCAATT
TATGCAGATTCTTAGAATCTTCATATTTAGAGATTGCCAAATTTGAATATATAAATTCAA
AAGATAAATAAGAAAGGTCATGCTATTTGCTATAGCAATACTCAATTAGAAGAAGACAAA
AAATATTTAATAAGATTAACTATTTAATCAAATCCGAAAAATTCAAATAACTTGATTTTG
TTTGGTTTAATACCTGAGTAAAGTAAAGACATATCATATCTCAGAGACTCAGGTTTAACT
TACAATGAGAGAGCAGATAGTTGCTACACTTTAACAAAGCTTATCAAAGGTGATCCAATT
CCTGAAATAAATAAGCTGAACATAAACAAGCAAATAGAGATAAGGATTCATCTTAAAAAA
AAACTATTTAGAATTGCTACGATTCCAGGCTACGAAAATATTTCTGAGTTAGATAATAGA
AATAGAATTAAAGATAATCTTAATTATAGATTTGGTATTGAGCTATACTAATAAGACGAT
TAAATTATTATAAATGAGTTTATGGTAGAAGATTAATTTAATGATGACATGTGA


>TTHERM_00576820(protein)
MINQEKGTDKILQIQEILSRQCPKHNEYPLDLLYITNKSNQHEICYMCFQSYPIKKEEII
NIRQILFAKEDTVLQNYPPLENQNLYTQLINIFNEQMILDQSIIKIQQFFKEFEEKLIGI
IKQLQRDMENKIENIKYLKKQLVETYNSISQKSELKNYFQNNNKDNSALHDLISKKFDEL
PENTQKIKELIDKFNTYKRSVNFDGPVKIEEAVISLMNQIDFFSDFNAEKYTQIIFQQEL
NDNHKYQLLNTSKQKKTNVDYLLELIKNQTNYCNNSSYDEIQKLLKKYSLLLNQIELNQP
IWEEAKRNSFVNLSDQQLERVRLISEKIISIDKQYEENEASSSLKEDSALSDKSLQNYQP
YCLQACIQPNSYEIYNNLFSGKASQYQRFQNLLKEYPIFELDSVQVGCHQLIFFNMIKSI
YADSQNLHIQRLPNLNIQIQKINKKGHAICYSNTQLEEDKKYLIRLTIQSNPKNSNNLIL
FGLIPEQSKDISYLRDSGLTYNERADSCYTLTKLIKGDPIPEINKLNINKQIEIRIHLKK
KLFRIATIPGYENISELDNRNRIKDNLNYRFGIELYQQDDQIIINEFMVEDQFNDDM


>TTHERM_00576820(gene)
ATGATTAATTAAGAAAAAGGAACCGACAAAATTCTACAAATATAAGAAATATTAAGTAGA
TAATGTCCTAAACATAATGAGTATCCTCTTGACCTTCTTTATATCACAAATAAATCTAAT
CAGCATGAAATTTGCTATATGTGTTTTTAGAGTTATCCAATAAAAAAAGAAGAAATTATC
AATATTAGATAGATTCTATTTGCAAAAGAAGATACTGTCCTTTAAAATTACCCTCCTTTA
GAGAATTAAAATTTGTATACTTAGTTGATTAATATTTTCAACGAATAAATGATCCTTGAT
TAATCAATCATTAAAATCTAGCAATTTTTCAAAGAGTTTGAAGAAAAGTTAATAGGTATT
ATTAAGCAATTACAAAGGGATATGGAAAATAAAATTGAAAATATAAAATATTTAAAAAAA
CAATTAGTTGAAACTTATAATTCTATTTCTTAAAAATCTGAATTAAAGAACTATTTTCAA
AATAACAACAAGGATAATTCTGCTCTGCACGATCTAATTTCTAAAAAATTTGACGAGTTA
CCAGAAAACACATAAAAAATAAAAGAATTAATAGATAAATTTAATACCTATAAAAGATCA
GTAAATTTCGATGGACCTGTTAAAATAGAAGAAGCAGTCATAAGTTTAATGAATTAAATA
GACTTTTTCTCAGACTTCAATGCTGAAAAATACACTTAAATAATATTTTAATAGGAGTTA
AACGATAATCATAAATACTAACTGTTAAATACAAGTAAACAAAAAAAGACAAATGTTGAT
TATTTGTTAGAACTTATTAAAAACTAGACAAATTATTGCAATAATTCAAGCTATGATGAA
ATTTAAAAGCTACTGAAAAAATATTCATTGCTTTTAAATTAAATTGAATTAAATTAACCA
ATTTGGGAAGAAGCTAAAAGAAATAGCTTCGTTAACCTTAGCGATTAGCAGCTAGAAAGA
GTAAGACTCATTTCAGAAAAGATTATTTCTATTGATAAATAATACGAAGAAAATGAAGCA
TCATCTTCACTTAAAGAAGACTCTGCTCTTTCAGATAAAAGCTTATAAAATTATTAGCCT
TACTGTTTGTAAGCTTGTATTTAACCTAATTCTTATGAAATATACAATAATTTGTTCAGT
GGAAAAGCAAGTTAGTATTAGAGATTTTAAAATTTATTAAAAGAGTACCCCATTTTTGAG
CTAGATAGTGTATAAGTTGGTTGCCATTAATTAATATTTTTTAATATGATAAAATCAATT
TATGCAGATTCTTAGAATCTTCATATTTAGAGATTGCCAAATTTGAATATATAAATTCAA
AAGATAAATAAGAAAGGTCATGCTATTTGCTATAGCAATACTCAATTAGAAGAAGACAAA
AAATATTTAATAAGATTAACTATTTAATCAAATCCGAAAAATTCAAATAACTTGATTTTG
TTTGGTTTAATACCTGAGTAAAGTAAAGACATATCATATCTCAGAGACTCAGGTTTAACT
TACAATGAGAGAGCAGATAGTTGCTACACTTTAACAAAGCTTATCAAAGGTGATCCAATT
CCTGAAATAAATAAGCTGAACATAAACAAGCAAATAGAGATAAGGATTCATCTTAAAAAA
AAACTATTTAGAATTGCTACGATTCCAGGCTACGAAAATATTTCTGAGTTAGATAATAGA
AATAGAATTAAAGATAATCTTAATTATAGATTTGGTATTGAGCTATACTAATAAGACGAT
TAAATTATTATAAATGAGTTTATGGTAGAAGATTAATTTAATGATGACATGTGA