Identifiers and Description

Gene Model Identifier

TTHERM_01040860

Standard Name

JSL3 (JUB6-Like 3)

Aliases

PreTt01801 | 207.m00045 | MixT

Description

tRNA-(guanosine-N1-)-methyltransferase; SPOUT family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_01040860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03361.12.000704504372864e-47hypothetical protein (568 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27909245: Kataoka K, Mochizuki K (2017) Heterochromatin aggregation during DNA elimination in Tetrahymena is facilitated by a prion-like protein. Journal of cell science 130(2):480-489
  2. Ref:SUPR000355

Sequences

>TTHERM_01040860(coding)
ATGGAAAATATATTAAATAATAGTTAAAATTTTAAGCAAATACTTTGCTAAAAGCATAAT
TTAACCTGCTTATGTTTACAAACTGATAGTGATGACTCTGATGATATCTATGCTTGCTCT
AATTGTATTCGTTCTAATAATAATTTCAAATAATGTCTGCTTTTATAAGATATAAAAGAT
AAATTAGACAATACAGTCTTAACAAATTGGCCACTATTAGATGAATATGATTTAATGATA
CAAATTTAGTCATTTTCTAAGTATTAAGGAAATTAAAACTTAATTTAAAAGGATATAGTT
AAGTTCTTTGAAGATTTTTAAAATGAATTAGAACATACATTGCAAAAATAAAAGAAGAAT
ATGCTAATCTATGCAGATGGTATTTCCGAAAAGACAAACCAGTTATTTGATTATTATCGA
GAAATAGCTTAATTTGATGCTCTAAAAAATATTATAGATTCTGATACATAAAAATAATAA
TAAGCTGAACAAATTTTATAAATATTTAAGACAAACAAATAGAATCAAGAAAACTATAAA
AATAAAATTTAATAACAATTATCTCAATTAAATCAATACTAAACCATAAATTTAAATGTA
CTCAAATCTTTTAAAGATTCTATTTTATCATAAATCGAGCTAGTTGATGGTAAATATTTA
TCTAATTTACAGCTTTTCTCCTAAAAAAATAATATACTAATTGAAGAATTTAAAAAATAA
TAACAAAATTAAAATATTTTGTTAAAAGAAAATGAAAATTTATACACACTTCTCAACCTT
ATAGGAAATAAAACTAACAATTGTAATGAAAATTATCTTTAATCTGTTAAGTCTGAACTC
CTAAAAATTTAAGATTTAATAAATATCTTAAATATTGACAAGGATGTTTTTTAGCAAGGC
AAGAAATAAATTCAAATAGGTTTAGAAAAATTAAGCTAAGATCAAATTGAATACATAGAA
ACACTTGTAAATAAAATCGTTGATCTAAATGAGTAATACTAATAATTGAAAGAAGAAGAT
AATAATATGATCATCTCTTCAAAATTATAACCTTCCTCCTACCTAATTTATAATTAGATA
TTCAAGCTAGATAAAAAATTGACAAAATAGAAATTAGAGAGTATCACTAAGCTACTGAGA
AGGTTTCCTATTTTTGAAATCGAATAATTAGTCAAACCTTATCCTTGCAAGTTAGAAGTA
GAAATAAGTAATTAGAATAATTATAATACTAATGGAAAATAAAGCTATGATAATGAAGGC
AACTAAAAATTTGAAATTGTTAAAGAAGGTTTTTTTATTTTTTACATGAAAATAAAATAG
GATTGTTTGTATAGAATAGTTATTAATCTTGAATTAAAATATCCAAATAGATATTTATTT
ATTGGTCTAGTTGGTAAATCTCACAAAGATTAGAAATATATTTATGAAAATAGCTTTATT
AATAGTTTTACAACTGAAAGTAGTTATAGTGATAGAGGAGTTAGCAAAGTAATAAAAGGG
AAATGCTTGAGAGATGTGAAATATCCAGAAGAATATAATTAGATAGAAATAAGATTTTGT
GTAAAAAATAAAATGTTCTAAGTGAGTGATTATCCTAAAAGAGAAAATATTAATGAAATA
AATGATGATAAGTTAAATTTAATAGACCTAAACTAAGAATATTATTTAGGATTTGAATTA
GTTTATGACAAAGACTCTTTGACTATATTAGAGTGTGAAGAACTTTAATATTAAAATTGA


>TTHERM_01040860(protein)
MENILNNSQNFKQILCQKHNLTCLCLQTDSDDSDDIYACSNCIRSNNNFKQCLLLQDIKD
KLDNTVLTNWPLLDEYDLMIQIQSFSKYQGNQNLIQKDIVKFFEDFQNELEHTLQKQKKN
MLIYADGISEKTNQLFDYYREIAQFDALKNIIDSDTQKQQQAEQILQIFKTNKQNQENYK
NKIQQQLSQLNQYQTINLNVLKSFKDSILSQIELVDGKYLSNLQLFSQKNNILIEEFKKQ
QQNQNILLKENENLYTLLNLIGNKTNNCNENYLQSVKSELLKIQDLINILNIDKDVFQQG
KKQIQIGLEKLSQDQIEYIETLVNKIVDLNEQYQQLKEEDNNMIISSKLQPSSYLIYNQI
FKLDKKLTKQKLESITKLLRRFPIFEIEQLVKPYPCKLEVEISNQNNYNTNGKQSYDNEG
NQKFEIVKEGFFIFYMKIKQDCLYRIVINLELKYPNRYLFIGLVGKSHKDQKYIYENSFI
NSFTTESSYSDRGVSKVIKGKCLRDVKYPEEYNQIEIRFCVKNKMFQVSDYPKRENINEI
NDDKLNLIDLNQEYYLGFELVYDKDSLTILECEELQYQN


>TTHERM_01040860(gene)
ATGGAAAATATATTAAATAATAGTTAAAATTTTAAGCAAATACTTTGCTAAAAGCATAAT
TTAACCTGCTTATGTTTACAAACTGATAGTGATGACTCTGATGATATCTATGCTTGCTCT
AATTGTATTCGTTCTAATAATAATTTCAAATAATGTCTGCTTTTATAAGATATAAAAGAT
AAATTAGACAATACAGTCTTAACAAATTGGCCACTATTAGATGAATATGATTTAATGATA
CAAATTTAGTCATTTTCTAAGTATTAAGGAAATTAAAACTTAATTTAAAAGGATATAGTT
AAGTTCTTTGAAGATTTTTAAAATGAATTAGAACATACATTGCAAAAATAAAAGAAGAAT
ATGCTAATCTATGCAGATGGTATTTCCGAAAAGACAAACCAGTTATTTGATTATTATCGA
GAAATAGCTTAATTTGATGCTCTAAAAAATATTATAGATTCTGATACATAAAAATAATAA
TAAGCTGAACAAATTTTATAAATATTTAAGACAAACAAATAGAATCAAGAAAACTATAAA
AATAAAATTTAATAACAATTATCTCAATTAAATCAATACTAAACCATAAATTTAAATGTA
CTCAAATCTTTTAAAGATTCTATTTTATCATAAATCGAGCTAGTTGATGGTAAATATTTA
TCTAATTTACAGCTTTTCTCCTAAAAAAATAATATACTAATTGAAGAATTTAAAAAATAA
TAACAAAATTAAAATATTTTGTTAAAAGAAAATGAAAATTTATACACACTTCTCAACCTT
ATAGGAAATAAAACTAACAATTGTAATGAAAATTATCTTTAATCTGTTAAGTCTGAACTC
CTAAAAATTTAAGATTTAATAAATATCTTAAATATTGACAAGGATGTTTTTTAGCAAGGC
AAGAAATAAATTCAAATAGGTTTAGAAAAATTAAGCTAAGATCAAATTGAATACATAGAA
ACACTTGTAAATAAAATCGTTGATCTAAATGAGTAATACTAATAATTGAAAGAAGAAGAT
AATAATATGATCATCTCTTCAAAATTATAACCTTCCTCCTACCTAATTTATAATTAGATA
TTCAAGCTAGATAAAAAATTGACAAAATAGAAATTAGAGAGTATCACTAAGCTACTGAGA
AGGTTTCCTATTTTTGAAATCGAATAATTAGTCAAACCTTATCCTTGCAAGTTAGAAGTA
GAAATAAGTAATTAGAATAATTATAATACTAATGGAAAATAAAGCTATGATAATGAAGGC
AACTAAAAATTTGAAATTGTTAAAGAAGGTTTTTTTATTTTTTACATGAAAATAAAATAG
GATTGTTTGTATAGAATAGTTATTAATCTTGAATTAAAATATCCAAATAGATATTTATTT
ATTGGTCTAGTTGGTAAATCTCACAAAGATTAGAAATATATTTATGAAAATAGCTTTATT
AATAGTTTTACAACTGAAAGTAGTTATAGTGATAGAGGAGTTAGCAAAGTAATAAAAGGG
AAATGCTTGAGAGATGTGAAATATCCAGAAGAATATAATTAGATAGAAATAAGATTTTGT
GTAAAAAATAAAATGTTCTAAGTGAGTGATTATCCTAAAAGAGAAAATATTAATGAAATA
AATGATGATAAGTTAAATTTAATAGACCTAAACTAAGAATATTATTTAGGATTTGAATTA
GTTTATGACAAAGACTCTTTGACTATATTAGAGTGTGAAGAACTTTAATATTAAAATTGA